DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_036910.1 Gene:Aqp1 / 25240 RGDID:2141 Length:269 Species:Rattus norvegicus


Alignment Length:270 Identity:90/270 - (33%)
Similarity:148/270 - (54%) Gaps:19/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVL----LATALASGLAMATLTQ 115
            |.:||:...|||::::|.||..::|||..|:|.|.......:..|    :..:||.||::|||.|
  Rat     1 MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQ 65

  Fly   116 CFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISH 180
            ...||||||:||||||.|.:...||.:||.|||.|||.|.|..:|:|.|:|....:.:| .....
  Rat    66 SVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLLENSL-GRNDL 129

  Fly   181 SAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY----LNPA 240
            :..:.:.:..|:|.|.|..:|||...:||..::.:|.|| .:||.:.:....:::.|    :|||
  Rat   130 ARGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPA 194

  Fly   241 RSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSIDNDSSSIHSEDEL- 304
            ||.|.:.:...:.:||::|.||.:|...:.|:|::|...|:.:.        .|...:.:..:: 
  Rat   195 RSFGSAVLTRNFSNHWIFWVGPFIGSALAVLIYDFILAPRSSDF--------TDRMKVWTSGQVE 251

  Fly   305 NYDMDMEKPN 314
            .||:|.:..|
  Rat   252 EYDLDADDIN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 81/223 (36%)
Aqp1NP_036910.1 MIP 4..227 CDD:395174 81/223 (36%)
NPA 1 76..78 1/1 (100%)
NPA 2 192..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.