DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp-6

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001256246.1 Gene:aqp-6 / 183121 WormBaseID:WBGene00000174 Length:291 Species:Caenorhabditis elegans


Alignment Length:267 Identity:87/267 - (32%)
Similarity:126/267 - (47%) Gaps:49/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SSTLQAPKRSMQAEIRTLEFWR--SIISECLASF----MYVFIVCGAAAGVGVGASVSSVLLATA 103
            :||::..|.|.....:.:|..:  :|.|:|.|.|    ::|:|....||||.:...|    |..|
 Worm    32 NSTMENLKNSSDIVPKMVEDEKDYTIYSKCAAEFIAVLLFVYIGSMQAAGVFLHDGV----LHAA 92

  Fly   104 LASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVP 168
            .|.|:|:..|...|..:||||||||||..:.:|..||||.|..|:.:|..|.:.| |||..:::|
 Worm    93 FAHGVAIFVLAATFGGVSGAHINPAVTFGIALVGRISPIHAVCYVVSQLLGSVFG-ALLVRISLP 156

  Fly   169 GYQGNLQAAISHSAALAA----W-ERFGVEFILTFL----VVLCYFVSTDPMKKFMGNSAASIGC 224
            ....|:   ||..|.|..    | |....|.:.|::    |:|| .|.||.      |..|.:..
 Worm   157 YKMYNV---ISAGATLCGKGYNWQEGLTAEIVTTYILVQTVLLC-AVDTDK------NRLAPLAI 211

  Fly   225 AYS------ACCFVSMPYLNPARSLGPSF---VLNK----------WDSHWVYWFGPLVGGMASG 270
            .:|      |...:|...:|||||.||:.   |..|          |:.||:|:.||::|...:.
 Worm   212 GFSLIIEILAAGAISGASMNPARSFGPNIMGQVFLKPEHLDAQYMYWNYHWIYYIGPIIGAFIAA 276

  Fly   271 LVYEYIF 277
            .||...|
 Worm   277 GVYRMFF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 80/248 (32%)
aqp-6NP_001256246.1 MIP 60..282 CDD:238204 79/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.