DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp-8

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001359963.1 Gene:aqp-8 / 180744 WormBaseID:WBGene00000176 Length:330 Species:Caenorhabditis elegans


Alignment Length:318 Identity:68/318 - (21%)
Similarity:122/318 - (38%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGA 123
            |...:|.|.:::||:.:|..:.|  |.||.:....:|.....:..:|.|:...........:||.
 Worm    14 IEDQQFTRELLAECIGTFFLLLI--GNAANIQAAVAVGGNSTSCHIAWGIGFMFAVYLAASVSGG 76

  Fly   124 HINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNL--------QAAISH 180
            |:|||:::|..::.::.|.:...|..||..|...|||:.|.    |:..:|        |.....
 Worm    77 HLNPAISVAQSILGNLPPWKIIPYAIAQVIGAFLGAAVAYF----GHHDDLWKLDGGIRQVTGGQ 137

  Fly   181 SAA----------LAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSAASIGCAYSACCFVSMP 235
            :.|          ::.|.....:.|.|.::.....:.||  |:....:......|.|....|:|.
 Worm   138 ATAGLFTTFPPDHMSVWGSLLDQIIGTAMLSGLVCLITD--KRHQIPTGVVPVLAGSIMSMVAMT 200

  Fly   236 Y-------LNPARSLGPS-FVL---NKWD---SHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRH 286
            :       :||||..||. |.|   ..|:   :|..|::.|:||.:...::..:|:..       
 Worm   201 FGANGGFAINPARDFGPRVFCLCAGYGWEVFSAHGYYFWIPIVGALIGSIIGAWIYKI------- 258

  Fly   287 NKGSIDNDSSSIHSEDELNYDMDMEKPNKYQQSQGT-------YPRGQSNGNGGGQAA 337
                    ...:|.   :|..:|::....:.:.|..       |....|...||..||
 Worm   259 --------FVGLHG---MNESLDIQPAKGFNEMQRNSEGILIGYDNTLSRARGGEIAA 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 57/245 (23%)
aqp-8NP_001359963.1 MIP 21..261 CDD:350945 56/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.