DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp-2

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001379056.1 Gene:aqp-2 / 174467 WormBaseID:WBGene00000170 Length:290 Species:Caenorhabditis elegans


Alignment Length:296 Identity:70/296 - (23%)
Similarity:113/296 - (38%) Gaps:82/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EFWRSIISECLASFMYVFIVCGAAA-------------GVGVGASVSSVLLATALASGLAMATLT 114
            |..|::::|...:::...|.....|             ||.||..:       |:..|:|::.  
 Worm    15 ELLRAVLAEFTGTYLLCLIGLSVVAQKVLPRPEVNEFIGVNVGFGI-------AIVFGVAVSA-- 70

  Fly   115 QCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGV-------------T 166
                .:||.||||||:.|...|..|:.::...|..||..|...|||.:|.|             |
 Worm    71 ----KLSGGHINPAVSFAFLSVGQITIVQFIAYFVAQFFGAFFGAATVYAVYNDAINVFDGGVRT 131

  Fly   167 VPGYQGNLQAAISHSAA-LAAWERFGVEFILT--FLVVLCYFVS--------TDPMKKFMGNSAA 220
            |.|.:.......|:.|. |.....|..:|:.|  |:.::.:.|.        ..|:  .:|....
 Worm   132 VGGPKDTAGIFASYPAPHLGLVNGFVDQFVATAVFVFLIAHIVDKRNSYPTWLQPI--LVGTGFV 194

  Fly   221 SIGCAYSACCFVSMPYLNPARSLGPSF---------VLNKWDSHWVYWFGPLVGGMASGLVY--- 273
            :||.|:...|  ..| :||||...|..         |..||  .||...||.||.:....:|   
 Worm   195 AIGAAFGYNC--GYP-VNPARDFAPRLFTSIFYGGAVFTKW--FWVPIVGPFVGAVVGIWLYYFL 254

  Fly   274 -----------EYIFNSRNRNLR--HNKGSIDNDSS 296
                       :|:..:.|:.|:  ..|.::|.:::
 Worm   255 IGFHTPQDAEEKYVVLTGNQELKPLTAKETVDEEAA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 64/255 (25%)
aqp-2NP_001379056.1 MIP 18..254 CDD:238204 64/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.