DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp8

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_031500.1 Gene:Aqp8 / 11833 MGIID:1195271 Length:261 Species:Mus musculus


Alignment Length:253 Identity:81/253 - (32%)
Similarity:117/253 - (46%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KRSMQAEIRTLEFW-----RSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMA 111
            |.||....|.  ||     :..|.|.:.|.:::||.|.:.    :..|.::.||..|||.|||:.
Mouse    19 KTSMAGRCRV--FWYEQYVQPCIVELVGSALFIFIGCLSV----IENSPNTGLLQPALAHGLALG 77

  Fly   112 TLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVP----GYQG 172
            .:.....:|||.|.||||:||:.|:..:..:....|..:|..||:.||||...|:..    ...|
Mouse    78 LIIATLGNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFGGLIGAALAKVVSPEERFWNASG 142

  Fly   173 NLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSAA-SIGC----------AY 226
            ...|.:.....:|  |..|:|.|||.|:||...:.. ..:|.||..|. |||.          :.
Mouse   143 AAFAIVQEQEQVA--EALGIEIILTMLLVLAVCMGA-VNEKTMGPLAPFSIGFSVIVDILAGGSI 204

  Fly   227 SACCFVSMPYLNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNL 284
            |..|      :||||:.||:.:...||.||:||.|||:.|:..||:...:.......|
Mouse   205 SGAC------MNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLLIRLLIGDEKTRL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 77/234 (33%)
Aqp8NP_031500.1 MIP 38..248 CDD:294134 74/222 (33%)
NPA 1 92..94 1/1 (100%)
NPA 2 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.