DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp7

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001365567.1 Gene:Aqp7 / 11832 MGIID:1314647 Length:316 Species:Mus musculus


Alignment Length:300 Identity:76/300 - (25%)
Similarity:120/300 - (40%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APKRSMQAEIRTLEFWRSIISECLASFM--YVFIV--CGAAAGVGVGASVSSVLLATALASGLAM 110
            ||:..::.....|:  ::::.|.||.|:  ||.:|  .|:.|.:.:|.: |...|...|..|..:
Mouse     2 APRSVLETIQSVLQ--KNMVREFLAEFLSTYVMMVFGLGSVAHMVLGEN-SGSYLGVNLGFGFGV 63

  Fly   111 ATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAA----LLYGVTVPGYQ 171
            .........|||||:|.|||...|.:..::..:..:|:..|..|..:.||    :.||.......
Mouse    64 TMGVHVAGGISGAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAINHFAG 128

  Fly   172 GNLQAAISHSAA----------LAAWERFGVEFILTFLVVLCYFVSTDPMKK----FMGNSAASI 222
            |:|....|.:.|          :..|..|..|..:|.::.||.|..||  ||    ..|.....|
Mouse   129 GDLLVTGSKATANIFATYLPEYMTLWRGFLDEAFVTGMLQLCLFAITD--KKNSPALQGTEPLVI 191

  Fly   223 GCAYSACCFVSMPY-----LNPARSLGP---SFVLNKWDSHWVYWFGP----------LV----G 265
            |...:. ..||:..     :||:|.|.|   :|:.. |...   .|.|          ||    |
Mouse   192 GILVTV-LGVSLGMNSGYAINPSRDLPPRLFTFIAG-WGKQ---VFRPPSFCLQSRKQLVVGAGG 251

  Fly   266 GMASGLVYEYI----FNSRNRNLRHNKGSIDNDSSSIHSE 301
            |..||.:..:.    |||.    :|..||  :::...:|:
Mouse   252 GTTSGRLPRWYCIPGFNSP----QHTTGS--SETGEFYSK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 67/258 (26%)
Aqp7NP_001365567.1 MIP 18..232 CDD:412216 58/221 (26%)
NPA 1 79..81 1/1 (100%)
NPA 2 211..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.