DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp6

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_780296.1 Gene:Aqp6 / 11831 MGIID:1341204 Length:293 Species:Mus musculus


Alignment Length:221 Identity:84/221 - (38%)
Similarity:122/221 - (55%) Gaps:21/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RSIISECLASFMYVFIVCGAAAGVGVGA------SVSSVLLATALASGLAMATLTQCFLHISGAH 124
            :::.:|.||:.:|||.        |||:      ::.|| |..|:...||.||..|.....||||
Mouse    22 KALFAEFLATGLYVFF--------GVGSVLPWPVALPSV-LQIAITFNLATATAVQISWKTSGAH 77

  Fly   125 INPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAALAAWER 189
            .|||||||..|...||..||..||.||..|..||||||||||..|.:..|...:.|::. :..:.
Mouse    78 ANPAVTLAYLVGSHISLPRAMAYIAAQLAGATAGAALLYGVTPGGIRETLGVNVVHNST-STGQA 141

  Fly   190 FGVEFILTFLVVLCYFVSTDPMKKFMGNSAASIGCAYSACCFVSMPY----LNPARSLGPSFVLN 250
            ..||.:||..:|||.|.|.|. ::.:.:.||.||.:.:....:.:.:    :|||||.||:.::.
Mouse   142 VAVELVLTLQLVLCVFASMDG-RQTLASPAAMIGTSVALGHLIGIYFTGCSMNPARSFGPAVIVG 205

  Fly   251 KWDSHWVYWFGPLVGGMASGLVYEYI 276
            |:..||::|.|||.|.:.:.|:|.:|
Mouse   206 KFAVHWIFWVGPLTGAVLASLIYNFI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 82/216 (38%)
Aqp6NP_780296.1 MIP 22..228 CDD:294134 82/216 (38%)
NPA 1 79..81 1/1 (100%)
NPA 2 193..195 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.