DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp2

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_033829.3 Gene:Aqp2 / 11827 MGIID:1096865 Length:271 Species:Mus musculus


Alignment Length:284 Identity:101/284 - (35%)
Similarity:152/284 - (53%) Gaps:33/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISG 122
            |:|::.|.|::::|.||:.::||...|:|.   ..||....:|..|:|.||.:.||.|...|:||
Mouse     3 ELRSIAFSRAVLAEFLATLLFVFFGLGSAL---QWASSPPSVLQIAVAFGLGIGTLVQALGHVSG 64

  Fly   123 AHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAALAAW 187
            ||||||||:|..|...:|.:|||.|:.||..|.:||||:|:.:|....:|:|.....|:.|.|. 
Mouse    65 AHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPVEIRGDLAVNALHNNATAG- 128

  Fly   188 ERFGVEFILTFLVVLCYFVSTDPMKK-FMGNSAASIGCA----------YSACCFVSMPYLNPAR 241
            :...||..||..:|||.|.|||..:. .:|:.|.|||.:          ::.|.      :||||
Mouse   129 QAVTVELFLTMQLVLCIFASTDERRSDNLGSPALSIGFSVTLGHLLGIYFTGCS------MNPAR 187

  Fly   242 SLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHN----KGSIDNDSSSIHSED 302
            ||.|:.|..|:|.|||:|.|||||.:...|:|.|:.....::|:..    || ::.|:.....|.
Mouse   188 SLAPAVVTGKFDDHWVFWIGPLVGAVIGSLLYNYLLFPSTKSLQERLAVLKG-LEPDTDWEEREV 251

  Fly   303 ELNYDMDMEKPNKYQQSQGTYPRG 326
            .....:::..|.       :.|||
Mouse   252 RRRQSVELHSPQ-------SLPRG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 90/225 (40%)
Aqp2NP_033829.3 MIP 3..219 CDD:278651 90/225 (40%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P41181 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P41181 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.