DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and Aqp1

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_031498.1 Gene:Aqp1 / 11826 MGIID:103201 Length:269 Species:Mus musculus


Alignment Length:271 Identity:92/271 - (33%)
Similarity:150/271 - (55%) Gaps:21/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVL----LATALASGLAMATLTQ 115
            |.:||:...|||::::|.||..::|||..|:|.|.......:..|    :..:||.||::|||.|
Mouse     1 MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQ 65

  Fly   116 CFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNL-QAAIS 179
            ...||||||:||||||.|.:...||.:||.|||.|||.|.|...|:|.|:|......:| :..::
Mouse    66 SVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDNSLGRNDLA 130

  Fly   180 HSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY----LNP 239
            |  .:.:.:..|:|.|.|..:|||...:||..::.:|.|| .:||.:.:....:::.|    :||
Mouse   131 H--GVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINP 193

  Fly   240 ARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSIDNDSSSIHSEDEL 304
            |||.|.:.:...:.:||::|.||.:||..:.|:|::|...|:.:.        .|...:.:..::
Mouse   194 ARSFGSAVLTRNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDF--------TDRMKVWTSGQV 250

  Fly   305 -NYDMDMEKPN 314
             .||:|.:..|
Mouse   251 EEYDLDADDIN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 83/224 (37%)
Aqp1NP_031498.1 MIP 4..227 CDD:278651 83/224 (37%)
NPA 1 76..78 1/1 (100%)
NPA 2 192..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.