DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and LOC110438841

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_021327889.1 Gene:LOC110438841 / 110438841 -ID:- Length:396 Species:Danio rerio


Alignment Length:245 Identity:65/245 - (26%)
Similarity:113/245 - (46%) Gaps:35/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRTLEFWRSIISECLASFMYVFIVCGAA-----AGVGVGASVSSV-----------LLAT---- 102
            :|.::.|.|.:..|.|.:..::||...:|     ||   ..||.|:           |.:|    
Zfish   125 DILSILFLRDVFCEFLGTVFFLFISLSSAILWPHAG---SLSVVSIPDEPLPTLDSSLASTPDPL 186

  Fly   103 --ALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGV 165
              :||.|:::|....|   :...|:||.:||||.....:||.|..:.:.||....::..|:|. |
Zfish   187 HVSLAFGVSVARAGVC---LGEVHLNPVITLALVAGLRVSPWRGVLLVGAQLLAALSACAILL-V 247

  Fly   166 TVPGYQGNLQAAISHSAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSAASIGCAYSACC 230
            ..|..|.:....::....|  ::...|...:||.:|||...:|.|...|..|..|..|.:.:...
Zfish   248 IAPTTQSSNHGDVAPGVYL--YQALLVXTAVTFQLVLCVQAATHPKSAFSSNPPAVTGLSDTLGH 310

  Fly   231 FVSMPY----LNPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYI 276
            .:::.:    :|||||.||:.:...:.:|||||.||..|.:.:..:::.:
Zfish   311 LMAIGFTGCGMNPARSFGPAVLTMNFHNHWVYWVGPCSGSLLTWFLHDLL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 65/240 (27%)
LOC110438841XP_021327889.1 MIP 128..357 CDD:294134 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.