DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and LOC100509620

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_006712950.1 Gene:LOC100509620 / 100509620 -ID:- Length:375 Species:Homo sapiens


Alignment Length:302 Identity:72/302 - (23%)
Similarity:103/302 - (34%) Gaps:96/302 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GHGVNNRLSSTLQAPKRSMQAEIRTLEFW-----RSIISECLASFM--YVFIVCGAAAGVGVGAS 94
            ||..:.|.|..:   ..|:.|:|:  |.|     |.::.|.||.||  ||.:|      .|:|:.
Human    35 GHRRSTRGSKMV---SWSVIAKIQ--EIWCEEDERKMVREFLAEFMSTYVMMV------FGLGSV 88

  Fly    95 VSSVL-------LATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYITAQC 152
            ...||       |...|..|..:.........|||||:|.|||...|.:..:...:..:::..|.
Human    89 AHMVLNKTYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFTNCALGRVPWRKFPVHVLGQF 153

  Fly   153 GGGIAGAALLYGVTVPGYQGNLQAAISHSAA----------------------LAAWERFGVEFI 195
            .|....||.:|.:        ...||.|.:.                      :..|..|..|..
Human   154 LGSFLAAATIYSL--------FYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWRGFLNEEW 210

  Fly   196 LTFLVVLCYFVSTDPMKK--FMGNSAA-------------SIGCAYSACCFVSMPYLNPARSLGP 245
            ||.::.||.|..||....  ..|..|.             .|...|:         :||:|...|
Human   211 LTRMLQLCLFTITDQENNPALPGTHALVISILVVIIRVSHGINTGYA---------INPSRDPPP 266

  Fly   246 S---FVL-----------NKWDSHWVYWFGPLVGGMASGLVY 273
            |   |:.           |.|   ||....||:|....|::|
Human   267 SIFTFIAGWGKQVFSDGENWW---WVPVVAPLLGASLGGIIY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 65/279 (23%)
LOC100509620XP_006712950.1 MIP 64..313 CDD:294134 63/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.