DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and LOC100497434

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_002937066.2 Gene:LOC100497434 / 100497434 -ID:- Length:259 Species:Xenopus tropicalis


Alignment Length:242 Identity:77/242 - (31%)
Similarity:113/242 - (46%) Gaps:51/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ISECLASFMYVFIVCGAAAGVGVGASVSSVL--------LATALASGLAMATLTQCFLHISGAHI 125
            ::|.|.|.:::|:.|            .|||        |..||..|..:|::.....::||.|.
 Frog    40 VAELLGSTLFIFLGC------------LSVLVNPHNAGPLLPALVHGFTLASVISVLGNVSGGHF 92

  Fly   126 NPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAA------- 183
            ||||||::.:...::||....|...|..||:.||.|..|:...|      :.|:|:.|       
 Frog    93 NPAVTLSVVICGGLTPILLVPYWVCQLSGGMLGALLAKGLADHG------SFINHTGAACMLGSG 151

  Fly   184 -LAAWERFGVEFILTFLVVLCYF------VSTDPMK----KFMGNSAASIGCAYSACCFVSMPYL 237
             |.| ...|||.:|:||::....      :|..|:.    .|:..:|...|.:.|..|      |
 Frog   152 DLVA-RAVGVEIVLSFLLIFTVVMGAVGELSKTPLAPYSIAFVLTAAILSGGSISGSC------L 209

  Fly   238 NPARSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNL 284
            ||||:|||:.|.|.||.|||||.|||.|.:...|:|.:|...|:..|
 Frog   210 NPARALGPAVVANYWDYHWVYWVGPLAGALLVSLLYRFILAGRSHRL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 73/229 (32%)
LOC100497434XP_002937066.2 MIP 34..245 CDD:294134 73/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.