DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and LOC100491830

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_012813770.2 Gene:LOC100491830 / 100491830 -ID:- Length:276 Species:Xenopus tropicalis


Alignment Length:267 Identity:83/267 - (31%)
Similarity:131/267 - (49%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FWRSIISECLASFMYVFIVCGAAAGVGVGASVS-----SVLLATALASGLAMATLTQCFLHISGA 123
            |.||:.:|.|.:..:|.:        |:.:::|     ...|..:|..|||:||:.|...|||.|
 Frog    16 FLRSLFAEFLGTLFFVLL--------GLSSTLSWPKALPAALQISLTFGLAIATMVQTMGHISKA 72

  Fly   124 HINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAALAAWE 188
            |:|||||:|..:...||..:|.:|||.|..|.:.||.|||..|.....||....:. |...:..:
 Frog    73 HLNPAVTVAFLLAAHISISKAVLYITVQVLGAVVGAGLLYKFTPSNLHGNFGVNLL-SNGTSPGQ 136

  Fly   189 RFGVEFILTFLVVLCYFVSTDPMK-KFMGNSAASIGCAYSACCFVSMPY----LNPARSLGPSFV 248
            .|.||.:.|..:|||.|.:||..: ..:|:.:.|||.:.:...|:.:.:    :|||||..|:.:
 Frog   137 GFAVEVLTTMQLVLCIFATTDSHRMDNIGSPSISIGLSVTLGHFLGIYFTGCSMNPARSFAPALI 201

  Fly   249 LNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSIDNDSSSIHSEDELNYDMDMEKP 313
            ...:..|||.|.||:.||:.:.|:|.:|......:||:....:..           |||.:.|..
 Frog   202 TGNFTDHWVVWVGPMAGGIFASLIYNFILFPSKISLRNRLAILQG-----------NYDPEREGD 255

  Fly   314 NKYQQSQ 320
            .:..:.|
 Frog   256 REEHRKQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 74/218 (34%)
LOC100491830XP_012813770.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.