DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp5

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001297041.1 Gene:aqp5 / 100491662 XenbaseID:XB-GENE-479726 Length:289 Species:Xenopus tropicalis


Alignment Length:271 Identity:107/271 - (39%)
Similarity:155/271 - (57%) Gaps:24/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MQAEIRTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLH 119
            |:.|:.:|.||::|.:|.||:.::||...|:|  :...|::.:| |..:||.||.:.||.|...|
 Frog     1 MKRELCSLVFWKAIFAEFLATLIFVFFGLGSA--LRWPAALPTV-LQISLAFGLVIGTLVQSVGH 62

  Fly   120 ISGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAAL 184
            |||||||||||::..|...||.|||..||.||..||:|||.:||||..|..:||| |..:.|..:
 Frog    63 ISGAHINPAVTMSFLVGSQISLIRAFFYIIAQLLGGLAGAGILYGVVSPNVRGNL-AINTLSNNI 126

  Fly   185 AAWERFGVEFILTFLVVLCYFVSTDPMKK-FMGNSAASIGCAYSACCFVSMPY----LNPARSLG 244
            .....|.||.||||.:|:|.|.|||..:: .:|:.|.|||.:.:....|.:.:    :|||||..
 Frog   127 TPGVAFVVEMILTFQLVMCIFASTDSRREDNVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFA 191

  Fly   245 PSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIF----NSRNRNLRHNKGSIDNDSS--------- 296
            |:.|:.::.:|||:|.|||.|||.:.|.|.||.    .:|::.|....|:...:.|         
 Frog   192 PAVVVRRFTNHWVFWIGPLAGGMLASLTYNYILFPSTKTRSQKLAILLGTYVEEESWSDQQDNCK 256

  Fly   297 --SIHSEDELN 305
              |:..:|..|
 Frog   257 RQSLECDDRCN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 96/219 (44%)
aqp5NP_001297041.1 MIP 4..220 CDD:333943 96/219 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.