DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp8

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:NP_001107728.1 Gene:aqp8 / 100135726 XenbaseID:XB-GENE-481926 Length:269 Species:Xenopus tropicalis


Alignment Length:268 Identity:79/268 - (29%)
Similarity:112/268 - (41%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EAMRKDSHGGGHGVNNRLSSTLQAPKRSMQAEIRTLEFW-----RSIISECLASFMYVFIVCGAA 86
            |..:||...||                 .:..:.....|     :..::|.|.|.:::|..|   
 Frog    19 EMEKKDPEAGG-----------------KEEAVDISPHWFETYVQPCVAELLGSALFIFAGC--- 63

  Fly    87 AGVGVGASVSSVL---LATALASGLAMATLTQCFLHISGAHINPAVTLALCVVRSISPIRAAMYI 148
            ..|...||.:..|   ||..||.||.:|.|.    .|||.|.||||:||..::..::.|....|.
 Frog    64 LSVIENASTTGSLQPALAHGLALGLTIAVLG----GISGGHFNPAVSLAAWLIGGLNIILLVPYW 124

  Fly   149 TAQCGGGIAGAALLYGVTV-PGYQGNLQAAIS-----HSAALAAWERFGVEFILTFLVVLCYFV- 206
            ..|..||:.||||...|:. ..::....||.:     .|.|.|    .|.|.|:||.:|....: 
 Frog   125 VCQLCGGMIGAALAMAVSADTNFENATGAAFTTVKNDESVARA----IGAEIIMTFFLVFAVCMG 185

  Fly   207 -----STDPMKKFMGNSAASI----GCAYSACCFVSMPYLNPARSLGPSFVLNKWDSHWVYWFGP 262
                 |..|:..|......::    |.|.|..|      :||||:.||:.|.:.|..||:||.||
 Frog   186 AINEKSRTPLAPFCIGFTVTVDILAGGAISGAC------MNPARAFGPAVVADYWTFHWIYWVGP 244

  Fly   263 LVGGMASG 270
            |.||:..|
 Frog   245 LAGGLLVG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 74/237 (31%)
aqp8NP_001107728.1 MIP 48..258 CDD:294134 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.