DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bib and aqp10b

DIOPT Version :9

Sequence 1:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster
Sequence 2:XP_005159449.1 Gene:aqp10b / 100034395 ZFINID:ZDB-GENE-060503-57 Length:309 Species:Danio rerio


Alignment Length:302 Identity:77/302 - (25%)
Similarity:121/302 - (40%) Gaps:79/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECLASFMYVFIV----CGAAAGVGVGASVSSVLLATALASGLAMATLTQCFL--HISGAHINPAV 129
            ||||.|..|:::    ||:.|.|....:.....|:..|  |.|:.|....::  .:||||:||||
Zfish    17 ECLAEFFGVYVLILFGCGSVAQVTTSQNTKGEYLSINL--GFALGTTFGIYIAKGVSGAHLNPAV 79

  Fly   130 TLALCVVRSISPIRAAMYITAQCGGGIAGA---ALLYGVTVPGYQGNLQAAISHSAA-------- 183
            :::|||:...|..|...|:.:|..|....|   ||.|...:..:.|. ...:|.:.|        
Zfish    80 SVSLCVLGRFSWTRLPFYVCSQLFGAFLAAATVALQYYDAIMDFTGG-HLTVSGATATAGIFSTY 143

  Fly   184 ----LAAWERFGVEFILTFLVVLCYFVSTD-----------PMKKFMGNSAASIGCAYSACCFVS 233
                |:.|.....:.|.|..:::|.....|           |:  .:|.:...||.:..:    :
Zfish   144 PADYLSLWGGVVDQIIGTAALLVCVLALGDAHNTPAPAGLEPV--LVGAAVLVIGISMGS----N 202

  Fly   234 MPY-LNPARSLGP---SFVLNKWD-----SH-WVYWFGPL----VGGMASGLVYEYIFNSRNRNL 284
            ..| :||||..||   |::....|     .| |  |:.|:    ||.:...|:||.:.       
Zfish   203 SGYAINPARDFGPRLFSYIAGWGDEVFRAGHGW--WWVPIIVTCVGALLGSLLYELLI------- 258

  Fly   285 RHNKGSIDNDSSSIHSED---ELNYDMDME--------KPNK 315
                |....||.::..||   .|...::||        |.||
Zfish   259 ----GVHHPDSEAVDHEDPTAALQQTVEMEGAQSFDTIKENK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bibNP_001260313.1 MIP 58..273 CDD:278651 64/247 (26%)
aqp10bXP_005159449.1 MIP 5..247 CDD:294134 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.