DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13 and RPL13B

DIOPT Version :9

Sequence 1:NP_001033891.1 Gene:RpL13 / 34329 FlyBaseID:FBgn0011272 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_013862.1 Gene:RPL13B / 855173 SGDID:S000004750 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:95/207 - (45%)
Similarity:126/207 - (60%) Gaps:15/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKL 69
            |..|...|:.|.||..||..|:|..:||.|...|..:|..:.|||.. .||||||.||::|:.|:
Yeast     6 NLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPLD-LLRPVVRAPTVKYNRKV 69

  Fly    70 RAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIR 134
            ||||||||.|:|.||:.|.:|:|||||||.||:|::.|....|:||||||:||:|:||      |
Yeast    70 RAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQSKIIVFP------R 128

  Fly   135 AGESSLEECKLATQLKGPVLPIKNEQPAV-VEFREVTKDEKKFKAFATLRKARTDARLVGIRAKR 198
            .|::...|..|:.....|:     .|||. ||.|.|..:.:  .||.|||.||::.:..|||.||
Yeast   129 DGKAPEAEQVLSAAATFPI-----AQPATDVEARAVQDNGE--SAFRTLRLARSEKKFRGIREKR 186

  Fly   199 AKEAAESEDAAK 210
            |:|.||:|...|
Yeast   187 AREKAEAEAEKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13NP_001033891.1 Ribosomal_L13e 9..184 CDD:279617 79/175 (45%)
RPL13BNP_013862.1 Ribosomal_L13e 8..175 CDD:396042 82/180 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344404
Domainoid 1 1.000 136 1.000 Domainoid score I1073
eggNOG 1 0.900 - - E1_COG4352
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5568
Inparanoid 1 1.050 156 1.000 Inparanoid score I1078
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53560
OrthoFinder 1 1.000 - - FOG0001788
OrthoInspector 1 1.000 - - otm46941
orthoMCL 1 0.900 - - OOG6_100961
Panther 1 1.100 - - LDO PTHR11722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2753
SonicParanoid 1 1.000 - - X1141
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.