DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13 and BBC1

DIOPT Version :9

Sequence 1:NP_001033891.1 Gene:RpL13 / 34329 FlyBaseID:FBgn0011272 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001030831.1 Gene:BBC1 / 824062 AraportID:AT3G49010 Length:206 Species:Arabidopsis thaliana


Alignment Length:204 Identity:115/204 - (56%)
Similarity:145/204 - (71%) Gaps:1/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHT 67
            |.||:|||.|:.|.||.:|||||||||||.||...|.|||..:||||.||.|||||...|::|:.
plant     2 KHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQTLKYNM 66

  Fly    68 KLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKK 132
            |:|.|:||||||||.|||....|.|||||||.||||:|||..|.|:||||.|::||::||...:|
plant    67 KVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKTKLVIFPRRARK 131

  Fly   133 IRAGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRAK 197
            ::||:|:.||...|||::|..|||..|:| .:|..::|.:.|.||||..:|..||:.|..|.|||
plant   132 VKAGDSTPEELANATQVQGDYLPIVREKP-TMELVKLTSEMKSFKAFDKIRLERTNKRHAGARAK 195

  Fly   198 RAKEAAESE 206
            ||.||.:.|
plant   196 RAAEAEKEE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13NP_001033891.1 Ribosomal_L13e 9..184 CDD:279617 98/174 (56%)
BBC1NP_001030831.1 Ribosomal_L13e 6..185 CDD:396042 100/179 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 203 1.000 Domainoid score I842
eggNOG 1 0.900 - - E1_COG4352
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5568
Inparanoid 1 1.050 227 1.000 Inparanoid score I1161
OMA 1 1.010 - - QHG53560
OrthoDB 1 1.010 - - D1239434at2759
OrthoFinder 1 1.000 - - FOG0001788
OrthoInspector 1 1.000 - - otm2444
orthoMCL 1 0.900 - - OOG6_100961
Panther 1 1.100 - - O PTHR11722
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1141
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.