DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13 and rpl13

DIOPT Version :9

Sequence 1:NP_001033891.1 Gene:RpL13 / 34329 FlyBaseID:FBgn0011272 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_989111.1 Gene:rpl13 / 394716 XenbaseID:XB-GENE-964820 Length:211 Species:Xenopus tropicalis


Alignment Length:206 Identity:130/206 - (63%)
Similarity:154/206 - (74%) Gaps:9/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKL 69
            |.||...|:||.|||.|.|||||||||:||...|..||:.|.|||.||.:||||:|||||||||:
 Frog     6 NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQVKARLVAPRPVSGPVRPVVKCPTIRYHTKV 70

  Fly    70 RAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIR 134
            |.||||:|||||.|||....|:||||:||.||:|:|.|..|.|:|||||||||||:||......:
 Frog    71 RMGRGFSLEELKAAGINKKVARTIGISVDPRRRNRSTEGLQTNVQRLKEYRSKLIIFPRKPAAPK 135

  Fly   135 AGESSLEECKLATQLKGPVLPI----KNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIR 195
            .|:||.||.||||||||||:||    |.|:|     |.:|::||.|||||:||.||.:|||.|||
 Frog   136 KGDSSAEELKLATQLKGPVMPIRSVYKKEKP-----RVITEEEKNFKAFASLRMARANARLFGIR 195

  Fly   196 AKRAKEAAESE 206
            ||:||||||.:
 Frog   196 AKKAKEAAEQD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13NP_001033891.1 Ribosomal_L13e 9..184 CDD:279617 110/178 (62%)
rpl13NP_989111.1 Ribosomal_L13e 8..187 CDD:366562 114/183 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 224 1.000 Domainoid score I2497
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5568
Inparanoid 1 1.050 252 1.000 Inparanoid score I3137
OMA 1 1.010 - - QHG53560
OrthoDB 1 1.010 - - D1239434at2759
OrthoFinder 1 1.000 - - FOG0001788
OrthoInspector 1 1.000 - - oto105144
Panther 1 1.100 - - LDO PTHR11722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2753
SonicParanoid 1 1.000 - - X1141
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.