DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13 and rpl13

DIOPT Version :9

Sequence 1:NP_001033891.1 Gene:RpL13 / 34329 FlyBaseID:FBgn0011272 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_937786.1 Gene:rpl13 / 378961 ZFINID:ZDB-GENE-031007-1 Length:211 Species:Danio rerio


Alignment Length:205 Identity:131/205 - (63%)
Similarity:158/205 - (77%) Gaps:7/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKL 69
            |.||.|.|:||.||:.|:|||||||||:||...|..||:.:.|||.||.|||||||||||||||:
Zfish     6 NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPVVRCPTIRYHTKV 70

  Fly    70 RAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIR 134
            ||||||||||||.|||....|:||||:||.||:|:|.||.|.|:|||||||:|||:||....|.:
Zfish    71 RAGRGFTLEELKAAGINKKVARTIGISVDSRRRNRSTESLQANVQRLKEYRTKLIIFPRKAAKPK 135

  Fly   135 AGESSLEECKLATQLKGPVLPIK---NEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRA 196
            .|:|:.||.|:||||.|||:|||   .::.|    |.:::|||.|||||:||.||.:|||.||||
Zfish   136 KGDSTEEELKMATQLTGPVMPIKKVHKKEKA----RVISEDEKNFKAFASLRMARANARLFGIRA 196

  Fly   197 KRAKEAAESE 206
            ||||||||.:
Zfish   197 KRAKEAAEQD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13NP_001033891.1 Ribosomal_L13e 9..184 CDD:279617 110/177 (62%)
rpl13NP_937786.1 Ribosomal_L13e 11..184 CDD:279617 110/176 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583810
Domainoid 1 1.000 230 1.000 Domainoid score I2389
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5568
Inparanoid 1 1.050 259 1.000 Inparanoid score I3117
OMA 1 1.010 - - QHG53560
OrthoDB 1 1.010 - - D1239434at2759
OrthoFinder 1 1.000 - - FOG0001788
OrthoInspector 1 1.000 - - oto40567
orthoMCL 1 0.900 - - OOG6_100961
Panther 1 1.100 - - LDO PTHR11722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2753
SonicParanoid 1 1.000 - - X1141
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.