DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13 and Rpl13

DIOPT Version :9

Sequence 1:NP_001033891.1 Gene:RpL13 / 34329 FlyBaseID:FBgn0011272 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_058018.2 Gene:Rpl13 / 270106 MGIID:105922 Length:211 Species:Mus musculus


Alignment Length:205 Identity:130/205 - (63%)
Similarity:157/205 - (76%) Gaps:7/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKL 69
            |.||...|:||.||:.|.|||||||||:||...|..||:.:.||||||.:||:|||||:|||||:
Mouse     6 NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKV 70

  Fly    70 RAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIR 134
            ||||||:||||:.|||....|:||||:||.||:|||.||.|.|:||||||||||||||......:
Mouse    71 RAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK 135

  Fly   135 AGESSLEECKLATQLKGPVLPIKN---EQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRA 196
            .|:||.||.||||||.|||:||:|   ::.|    |.:|::||.|||||:||.||.:|||.||||
Mouse   136 KGDSSAEELKLATQLTGPVMPIRNVYKKEKA----RVITEEEKNFKAFASLRMARANARLFGIRA 196

  Fly   197 KRAKEAAESE 206
            ||||||||.:
Mouse   197 KRAKEAAEQD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13NP_001033891.1 Ribosomal_L13e 9..184 CDD:279617 109/177 (62%)
Rpl13NP_058018.2 Ribosomal_L13e 8..187 CDD:396042 113/182 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839722
Domainoid 1 1.000 225 1.000 Domainoid score I2531
eggNOG 1 0.900 - - E1_COG4352
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5568
Inparanoid 1 1.050 255 1.000 Inparanoid score I3166
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53560
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001788
OrthoInspector 1 1.000 - - oto94952
orthoMCL 1 0.900 - - OOG6_100961
Panther 1 1.100 - - LDO PTHR11722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2753
SonicParanoid 1 1.000 - - X1141
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.