DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13 and rpl13

DIOPT Version :9

Sequence 1:NP_001033891.1 Gene:RpL13 / 34329 FlyBaseID:FBgn0011272 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_593453.1 Gene:rpl13 / 2543553 PomBaseID:SPAC664.05 Length:208 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:105/212 - (49%)
Similarity:134/212 - (63%) Gaps:14/212 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHT 67
            ||  .:||.|:||.|||:||||||||.||:||...|..||..:.|||.. |:||.|:.|||||:.
pombe     6 KG--QLPNAHFHKDWQRYVKTWFNQPGRKLRRRQARQTKAAKIAPRPVE-AIRPAVKPPTIRYNM 67

  Fly    68 KLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKK 132
            |:||||||||||||.||:....|.||||.||.||:|:|.||.|||::|:|.|.:.||:||....:
pombe    68 KVRAGRGFTLEELKAAGVSRRVASTIGIPVDHRRRNRSEESLQRNVERIKVYLAHLIVFPRKAGQ 132

  Fly   133 IRAGE----SSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVG 193
            .:.|:    |..|:..:|.     ||||..|  ||.|.:.:|::.|.|.||:||...|..||..|
pombe   133 PKKGDATDVSGAEQTDVAA-----VLPITQE--AVEEAKPITEEAKNFNAFSTLSNERAYARYAG 190

  Fly   194 IRAKRAKEAAESEDAAK 210
            .||...|:.||..:|.|
pombe   191 ARAAFQKKRAEEAEAKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13NP_001033891.1 Ribosomal_L13e 9..184 CDD:279617 92/178 (52%)
rpl13NP_593453.1 Ribosomal_L13e 10..179 CDD:279617 90/176 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 171 1.000 Domainoid score I891
eggNOG 1 0.900 - - E1_COG4352
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5568
Inparanoid 1 1.050 185 1.000 Inparanoid score I1091
OMA 1 1.010 - - QHG53560
OrthoFinder 1 1.000 - - FOG0001788
OrthoInspector 1 1.000 - - oto101960
orthoMCL 1 0.900 - - OOG6_100961
Panther 1 1.100 - - LDO PTHR11722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2753
SonicParanoid 1 1.000 - - X1141
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.