DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13 and rpl-13

DIOPT Version :9

Sequence 1:NP_001033891.1 Gene:RpL13 / 34329 FlyBaseID:FBgn0011272 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001021017.1 Gene:rpl-13 / 171949 WormBaseID:WBGene00004425 Length:207 Species:Caenorhabditis elegans


Alignment Length:206 Identity:108/206 - (52%)
Similarity:138/206 - (66%) Gaps:9/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHT 67
            :||.|:.|.|:.|.|.:.:||||:|||||:||..||..||..:.|||.:|.||.|||||..||:|
 Worm     4 RGNQMLGNAHFRKHWHKRIKTWFDQPARKLRRRQNRQAKAVEIAPRPVAGLLRSVVRCPQKRYNT 68

  Fly    68 KLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKK 132
            |.|.||||:|:|||.|||....|:|||||||.||.||:.|..:.|..|||||::||||||.....
 Worm    69 KTRLGRGFSLQELKAAGISQAQARTIGIAVDVRRTNKTAEGLKANADRLKEYKAKLILFPKKASA 133

  Fly   133 IRAGESSLEECKLATQLKGPVLPIKN----EQPAVVEFREVTKDEKKFKAFATLRKARTDARLVG 193
            .:.|:||.||.|:|.||:|.|||:.:    ::|     |:||..|:|.:.|..|||.|.|.:..|
 Worm   134 PKKGDSSAEELKVAAQLRGDVLPLSHTITFDEP-----RQVTDAERKVEIFRLLRKERADKKYRG 193

  Fly   194 IRAKRAKEAAE 204
            .|.|||:||||
 Worm   194 KREKRAREAAE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13NP_001033891.1 Ribosomal_L13e 9..184 CDD:279617 92/178 (52%)
rpl-13NP_001021017.1 Ribosomal_L13e 11..184 CDD:279617 92/177 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161040
Domainoid 1 1.000 184 1.000 Domainoid score I2037
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5568
Inparanoid 1 1.050 207 1.000 Inparanoid score I2417
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53560
OrthoDB 1 1.010 - - D1239434at2759
OrthoFinder 1 1.000 - - FOG0001788
OrthoInspector 1 1.000 - - oto17939
orthoMCL 1 0.900 - - OOG6_100961
Panther 1 1.100 - - LDO PTHR11722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2753
SonicParanoid 1 1.000 - - X1141
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.