DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL13 and LOC100360491

DIOPT Version :9

Sequence 1:NP_001033891.1 Gene:RpL13 / 34329 FlyBaseID:FBgn0011272 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_038948782.1 Gene:LOC100360491 / 100360491 RGDID:2322065 Length:211 Species:Rattus norvegicus


Alignment Length:205 Identity:128/205 - (62%)
Similarity:155/205 - (75%) Gaps:7/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKL 69
            |.||....:||.||:.|.|||||||||:.|...|..||:.:.||||||.:||:|||||:|||||:
  Rat     6 NGMILKPLFHKDWQQRVDTWFNQPARKICRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKV 70

  Fly    70 RAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIR 134
            ||||||:||||:.|||....|:||||:||.||:|||.||.|.|:||||||||||||||......:
  Rat    71 RAGRGFSLEELRVAGIHKKMARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK 135

  Fly   135 AGESSLEECKLATQLKGPVLPIKN---EQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRA 196
            .|:||.||.||||||.|||:||:|   ::.|    |.:|::||.|||||:||.||.:|||.||||
  Rat   136 KGDSSAEELKLATQLTGPVMPIRNVYKKEKA----RAITEEEKNFKAFASLRMARANARLFGIRA 196

  Fly   197 KRAKEAAESE 206
            ||||||||.:
  Rat   197 KRAKEAAEQD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL13NP_001033891.1 Ribosomal_L13e 9..184 CDD:279617 107/177 (60%)
LOC100360491XP_038948782.1 Ribosomal_L13e 8..187 CDD:396042 111/182 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343552
Domainoid 1 1.000 226 1.000 Domainoid score I2429
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 256 1.000 Inparanoid score I3080
OMA 1 1.010 - - QHG53560
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001788
OrthoInspector 1 1.000 - - otm46228
orthoMCL 1 0.900 - - OOG6_100961
Panther 1 1.100 - - O PTHR11722
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1141
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.