DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dref and F28A10.4

DIOPT Version :9

Sequence 1:NP_001260311.1 Gene:Dref / 34328 FlyBaseID:FBgn0015664 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_493830.1 Gene:F28A10.4 / 185030 WormBaseID:WBGene00017872 Length:225 Species:Caenorhabditis elegans


Alignment Length:214 Identity:41/214 - (19%)
Similarity:76/214 - (35%) Gaps:87/214 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 MMNLKRT--------ISSVLQAHVISND-NLTAAALLDPRFHRLTTID--NLERTVRMLTHKYNI 565
            ::|||.|        :..:|:.::.|.| :.||..||    ||:..::  ..:...|..:..|: 
 Worm    30 LLNLKITMEICNWFGLKQLLEKYLDSEDFSQTAMVLL----HRIRVLEMKPTDPRKRFASESYS- 89

  Fly   566 NFGGVGEGESNEVAATSSV-----VAIKSEPRVVDGSAPKKLGLKLLFDSNEIPNPPKRDADSSV 625
                     |.:::..|.:     |.::::..:...|.|:|  :..|.|.:|:.|          
 Worm    90 ---------SQKISKRSPIPYRKAVTLQTDWIIEPPSVPEK--VPELIDVSELQN---------- 133

  Fly   626 ESDLKRYRNEVVVQLDESPIEWWLKMGHIYGTLRDLASLYHSVPGVVTLSFKKALRDQIYDFNKR 690
               |:::.                     |..||         |.::||:.|:.         |.
 Worm   134 ---LEQFE---------------------YERLR---------PTLITLTAKRL---------KS 156

  Fly   691 FMLTGSHIDAI---LFLHH 706
            ||.....|:.|   ||..|
 Worm   157 FMDRNPEIEKIADGLFRRH 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrefNP_001260311.1 zf-BED 35..84 CDD:280965
F28A10.4NP_493830.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.