DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dref and H25P06.5

DIOPT Version :9

Sequence 1:NP_001260311.1 Gene:Dref / 34328 FlyBaseID:FBgn0015664 Length:709 Species:Drosophila melanogaster
Sequence 2:NP_001368100.1 Gene:H25P06.5 / 13182103 WormBaseID:WBGene00219319 Length:140 Species:Caenorhabditis elegans


Alignment Length:143 Identity:33/143 - (23%)
Similarity:49/143 - (34%) Gaps:55/143 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 RFHR------LTTIDNLERTVRMLTHKYNINFGGVGEGESNEVA-----ATSSVVAIKSEPR--- 592
            |.||      |:.::||.:.:           .|...|.|.|:.     |....||..:.|.   
 Worm     2 RAHRDALRKKLSKLNNLMKAL-----------SGTDWGCSKELLLKTFNAIVKPVATYASPAWAQ 55

  Fly   593 -VVDGSAPK----------KLGLKLLFDSNEIPNPPKRD---------ADSSVES-------DLK 630
             |.|.|..|          |:||....:.|...||.|.:         :|:|.|.       |.|
 Worm    56 LVSDSSWNKIETTCSTNQDKIGLISAVEKNWGSNPDKPNQKTLKRSTISDNSCEPVAKKPEFDFK 120

  Fly   631 RYRNEVVVQLDES 643
            .:..|   :|:|:
 Worm   121 TFMQE---KLEEA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrefNP_001260311.1 zf-BED 35..84 CDD:280965
H25P06.5NP_001368100.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1121
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.