DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dref and LOC108183756

DIOPT Version :9

Sequence 1:NP_001260311.1 Gene:Dref / 34328 FlyBaseID:FBgn0015664 Length:709 Species:Drosophila melanogaster
Sequence 2:XP_021331252.1 Gene:LOC108183756 / 108183756 -ID:- Length:228 Species:Danio rerio


Alignment Length:226 Identity:46/226 - (20%)
Similarity:79/226 - (34%) Gaps:65/226 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 LSALVIALDTLRGEDIPLCSMLSPITSKILIKKLGIAEQDDPLMMNLKRTISSVLQ---AHVISN 530
            :..:|.||:.|:.|:......|.|:..::.| .|...|....:.:.|.|.:...:|   ..:|.:
Zfish    20 MKPVVKALNILQAENNTHMGWLLPVIFQLQI-NLCRLETSSKMCLPLIRAVQDGIQKCFGGMIQD 83

  Fly   531 DNLTAAALLDPRFHRLTTIDNLERT-------VRMLTH--------------------------K 562
            ....|.|:|.|:|....|    |:|       |.:..|                          |
Zfish    84 PEFIAPAILLPKFKNTWT----EKTDVIEAGLVYIRKHLDQMAEVAVEQDGQHSSDEDDFFSSMK 144

  Fly   563 YNINFGGVGEGESNEVAATSSVVAIKSEPRVVDGSAPKKLGLKL------------LFDSNEIPN 615
            :. ...|.||.:......:..:..:||.|.:      |||.|||            ||....:..
Zfish   145 FR-RSQGTGELDEYLFCVSDKMDLLKSFPHI------KKLSLKLNIALPASAACERLFSCAGLLF 202

  Fly   616 PPKRDADSSVESDLKRYRNEVVVQLDESPIE 646
            ..||...:|     ..:.|:::::|:...||
Zfish   203 NAKRARMNS-----SNFENQLLLKLNRKFIE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrefNP_001260311.1 zf-BED 35..84 CDD:280965
LOC108183756XP_021331252.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.