Sequence 1: | NP_001260311.1 | Gene: | Dref / 34328 | FlyBaseID: | FBgn0015664 | Length: | 709 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021331252.1 | Gene: | LOC108183756 / 108183756 | -ID: | - | Length: | 228 | Species: | Danio rerio |
Alignment Length: | 226 | Identity: | 46/226 - (20%) |
---|---|---|---|
Similarity: | 79/226 - (34%) | Gaps: | 65/226 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 469 LSALVIALDTLRGEDIPLCSMLSPITSKILIKKLGIAEQDDPLMMNLKRTISSVLQ---AHVISN 530
Fly 531 DNLTAAALLDPRFHRLTTIDNLERT-------VRMLTH--------------------------K 562
Fly 563 YNINFGGVGEGESNEVAATSSVVAIKSEPRVVDGSAPKKLGLKL------------LFDSNEIPN 615
Fly 616 PPKRDADSSVESDLKRYRNEVVVQLDESPIE 646 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dref | NP_001260311.1 | zf-BED | 35..84 | CDD:280965 | |
LOC108183756 | XP_021331252.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D223749at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |