DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dref and LOC101885930

DIOPT Version :9

Sequence 1:NP_001260311.1 Gene:Dref / 34328 FlyBaseID:FBgn0015664 Length:709 Species:Drosophila melanogaster
Sequence 2:XP_021322645.1 Gene:LOC101885930 / 101885930 -ID:- Length:202 Species:Danio rerio


Alignment Length:92 Identity:24/92 - (26%)
Similarity:38/92 - (41%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 LKLLFDSN---EIPNPPKRDADSSVESDLKRYRNEVVVQLDESPIEWWLKMGHIYGTLRDLASLY 665
            ||.|.|.:   .|.:...|.|:..|:.....|.:.:.|..:.|.     .:|.|...|..|.  :
Zfish    98 LKKLMDKDRLQRISDEDFRKAEEFVKITKILYTSTLCVSAERSQ-----NLGQILPILNKLQ--H 155

  Fly   666 HSVPGVVTLSFKKALRDQIY-DFNKRF 691
            |........||.|.::|.|: |.:||:
Zfish   156 HFTVNKEDSSFTKTIKDPIWNDLSKRY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrefNP_001260311.1 zf-BED 35..84 CDD:280965
LOC101885930XP_021322645.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.