DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5850 and AT1G11200

DIOPT Version :9

Sequence 1:NP_001260310.1 Gene:CG5850 / 34327 FlyBaseID:FBgn0032172 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_563884.1 Gene:AT1G11200 / 837661 AraportID:AT1G11200 Length:295 Species:Arabidopsis thaliana


Alignment Length:280 Identity:86/280 - (30%)
Similarity:160/280 - (57%) Gaps:20/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QLILIGGLF-VLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFFPKHS--- 110
            ::.::|.:| ||.::..::..:.||:.::.||..|:.|:.|:.|.|:||:|:::||...|.|   
plant    11 EITVMGSVFCVLLSMHFTMQLVSQHLFYWKKPNEQRAILIIVLMAPVYAINSFVGLLDAKGSKPF 75

  Fly   111 -IYVDSLRECYEAYVIYNFMVYLLNYLNLGMDLEATM-EYK-PQVPHFFPLCCMRPWVMGREF-- 170
             :::|:::|||||.||..|:..:.:|:|:.|...... |:| .::.|.||:....|.....::  
plant    76 FMFLDAVKECYEALVIAKFLALMYSYVNISMSARIIPDEFKGREIHHSFPMTLFVPRTTHLDYLT 140

  Fly   171 IHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYI-VVVNNISQFVAMYCLVLFY 234
            :...|....|:.::||:.:.:.:..::.|:|       .|...:| ..:.|:|..:|:|.||.||
plant   141 LKQLKQWTWQFCIIRPVCSILMITLQILGIY-------PVWLSWIFTAILNVSVSLALYSLVKFY 198

  Fly   235 RANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKD-IFGSDVGDTNLASLLQNFLI 298
            ....::|:|.||:.||:|:|.:|||.|:||::|.:||...:||. .|..:|  ..|...|||.|:
plant   199 HVFAKELEPHKPLTKFMCVKGIVFFCFWQGIVLKILVGLGLIKSHHFWLEV--DQLEEALQNVLV 261

  Fly   299 CIEMFIAAVAHIYSFPHHPF 318
            |:||.:.::...|:|...|:
plant   262 CLEMIVFSIIQQYAFHVAPY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5850NP_001260310.1 Solute_trans_a 51..317 CDD:281602 85/276 (31%)
AT1G11200NP_563884.1 Solute_trans_a 17..280 CDD:281602 84/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462913at2759
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.