DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5850 and tmem184b

DIOPT Version :9

Sequence 1:NP_001260310.1 Gene:CG5850 / 34327 FlyBaseID:FBgn0032172 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001039137.2 Gene:tmem184b / 733961 XenbaseID:XB-GENE-489974 Length:425 Species:Xenopus tropicalis


Alignment Length:356 Identity:117/356 - (32%)
Similarity:199/356 - (55%) Gaps:26/356 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFF---PKHSIYVDS 115
            |.|.||.:|:.::...|..|:..::.|..|:||:|||::|||||.::|:.|.|   .::.:|.|:
 Frog    60 ISGFFVWTALLITCHQIYMHLRSYSCPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFDT 124

  Fly   116 LRECYEAYVIYNFMVYLLNYLNLGMDLEATMEYKP-QVPHFFPLCCM--RPWVMGREFIHNCKHG 177
            :|:||||:|||||:.....||....::...:..|| :....:..||:  :.:.:|  |:..||..
 Frog   125 VRDCYEAFVIYNFLSLCYEYLGGESNIMTEIRGKPIESSCMYGTCCLWGKTYSIG--FLRFCKQA 187

  Fly   178 ILQYTVVRPITTFISVICELCGVYGEGEFAGNVA--FPYIVVVNNISQFVAMYCLVLFYRANKED 240
            .||:.||:|:...::||.:..|.|.:|:|  |||  :.|:.::.|||..:|:|.|.|||.|.:|.
 Frog   188 TLQFCVVKPLMAAVTVILQAFGKYRDGDF--NVASGYLYVTIIYNISVSLALYALFLFYFATREL 250

  Fly   241 LKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKDIFGSD--VGDTNLASLLQNFLICIEMF 303
            |.|..|:.||..:|:|:|.||:||:||.::.....|..|..::  ||:..:|:..|||:||:|||
 Frog   251 LSPYSPVLKFFMVKSVIFLSFWQGMLLAIMEKCGAIPKIDSAEVSVGEGTVAAGYQNFIICVEMF 315

  Fly   304 IAAVAHIYSFPHHPF---HINS---PQYWNNPNHSWCRAFLSMMDISDMQEDVTEHLGVVGSSLS 362
            .||:|..|:|.:..:   .:::   |.|  .| :..|....|:.  |.::|.:..| .:|..::.
 Frog   316 FAAIALRYAFTYKVYLDKRLDAQAVPTY--GP-YGRCAPMKSIS--SSLKETMNPH-DIVQDAIH 374

  Fly   363 RRFQGRSTYQPLARSPRRSSSESEYLISKRQ 393
            ........|...:...:.||..:..:||:.|
 Frog   375 NFSPAYQQYTQQSTLEQGSSWRNGQIISRSQ 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5850NP_001260310.1 Solute_trans_a 51..317 CDD:281602 102/272 (38%)
tmem184bNP_001039137.2 Solute_trans_a 57..328 CDD:367581 102/271 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D411703at33208
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1529
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.