DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5850 and tmem184a

DIOPT Version :9

Sequence 1:NP_001260310.1 Gene:CG5850 / 34327 FlyBaseID:FBgn0032172 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001016399.1 Gene:tmem184a / 549153 XenbaseID:XB-GENE-5747153 Length:434 Species:Xenopus tropicalis


Alignment Length:405 Identity:134/405 - (33%)
Similarity:218/405 - (53%) Gaps:41/405 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LIVNSVKDGFQRNDQLIL-------IGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMV 93
            |..||.:|    |||:.|       |.||||.:|:.::...|..|:.::|.|..|::|||||::|
 Frog    49 LAKNSSED----NDQIFLTTAAAKGISGLFVWTALLLTGHQIYLHLRNYTMPNEQRYIIRILFIV 109

  Fly    94 PIYALNAWIGLFF---PKHSIYVDSLRECYEAYVIYNFMVYLLNYLNLGMDLEATMEYKP-QVPH 154
            |||:.::|:.|..   .::.:|.||:|:||||:|||:|:.....||.....:.:.:..|| :...
 Frog   110 PIYSFDSWLSLLLIGNDQYYVYFDSIRDCYEAFVIYSFLSLCFEYLGGESAIMSEIRGKPIRSSC 174

  Fly   155 FFPLCCMRPWVMGREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVN 219
            ::..||::.......|:..||...||:.:|:||...:::|.:..|.|.:|:|.....:.||.::.
 Frog   175 YYGTCCLQGMSYSIGFLRFCKQATLQFCIVKPIMALVTIILQAFGKYHDGDFNVQSGYLYITIIY 239

  Fly   220 NISQFVAMYCLVLFYRANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNII---KDIFG 281
            |||..:|:|.|.|||.|.||.|:|.:|:.|||.||||:|.||:||:||.:|.....|   ::|..
 Frog   240 NISVSLALYALFLFYFATKELLQPFEPVLKFLTIKAVIFLSFWQGMLLAILERCGAIPEVQNINN 304

  Fly   282 SDVGDTNLASLLQNFLICIEMFIAAVAHIYSFPHHPFHINSPQYWNNPNHSWCRAFLSMMDISD- 345
            :.||...:|:..|||:|||||..||:|..|:|        :.|.:.....:.......|..||. 
 Frog   305 NMVGAGTVAAGYQNFIICIEMLFAAIALRYAF--------TCQVYREKKENSTANLAPMQSISSG 361

  Fly   346 MQEDVTEHLGVVGSSLSRRFQGRSTYQPLARSPRRSSSESEYLISKRQDQQLPGNSSQSAGVADD 410
            ::|.::.| .:|..:: ..|.  .|||   :..::|..:||   ||...|    |...:...::.
 Frog   362 LKETMSPH-DIVQDAI-HNFS--PTYQ---QYTQQSMQDSE---SKAAGQ----NGQPATSSSNS 412

  Fly   411 GNSSNSNYQQQQLHL 425
            |:||....|.:::.|
 Frog   413 GHSSKKKKQNEKMML 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5850NP_001260310.1 Solute_trans_a 51..317 CDD:281602 104/279 (37%)
tmem184aNP_001016399.1 Solute_trans_a 70..337 CDD:367581 103/274 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D411703at33208
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1529
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.