DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5850 and tmem184a

DIOPT Version :9

Sequence 1:NP_001260310.1 Gene:CG5850 / 34327 FlyBaseID:FBgn0032172 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_998685.2 Gene:tmem184a / 406841 ZFINID:ZDB-GENE-040426-2925 Length:420 Species:Danio rerio


Alignment Length:368 Identity:124/368 - (33%)
Similarity:200/368 - (54%) Gaps:28/368 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NDQLIL-------IGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLF 105
            :||:.|       :.|:||.||:.::...|..|:..:|.|..|::|||||::|||||.::|:.|.
Zfish    51 DDQIFLSTATAQALSGIFVWSALILTCHQIYLHLRSYTVPNEQRYIIRILFIVPIYAFDSWLSLL 115

  Fly   106 F---PKHSIYVDSLRECYEAYVIYNFMVYLLNYLNLGMDLEATMEYKP-QVPHFFPLCCMRPWVM 166
            |   .::.:|.||:|:||||:|||||:.....||.....:.:.:..|| |....:..||:.....
Zfish   116 FITNDQYYVYFDSVRDCYEAFVIYNFLSLSFEYLGGESAIMSEIRGKPIQSSCLYGTCCLVGMSY 180

  Fly   167 GREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVNNISQFVAMYCLV 231
            ...|:..||...||:.||:||...|:::.:..|.|.:|:|.....:.||.::.|.|..:|:|.|.
Zfish   181 SIGFLRFCKQATLQFCVVKPIMAVITILLQAFGKYHDGDFNVTGGYLYITIIYNFSVSLALYALF 245

  Fly   232 LFYRANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKD---IFGSDVGDTNLASLL 293
            |||.|..:.|:|.:|:.|||.||:|:|.||:||::|.:|....:|.:   |.|.:||...:|:..
Zfish   246 LFYFATSDLLRPFEPVLKFLTIKSVIFLSFWQGMVLAILERCGVIPEAQFIDGHEVGAGTVAAGW 310

  Fly   294 QNFLICIEMFIAAVAHIYSFPHHPFHINSPQYWNN--PNHSWCRAFLSMMDISDMQEDVTEHLGV 356
            |||:||||||.|::|..|:|....:.....:...|  |.|.........::..||.:|...:.  
Zfish   311 QNFIICIEMFFASIALRYAFTSSVYREKKNEAPENVAPMHGISSGLKETINPGDMVQDAIHNF-- 373

  Fly   357 VGSSLSRRFQGRST---YQPLAR-SPRRSSSESEYLISKRQDQ 395
              |...:::..:||   .||.|. .|..|:|:|    :|:.|:
Zfish   374 --SPAYQQYTQQSTQEVVQPSANGKPGISTSKS----TKKSDK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5850NP_001260310.1 Solute_trans_a 51..317 CDD:281602 104/279 (37%)
tmem184aNP_998685.2 Solute_trans_a 61..333 CDD:281602 103/271 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D411703at33208
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.