DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5850 and CG6836

DIOPT Version :9

Sequence 1:NP_001260310.1 Gene:CG5850 / 34327 FlyBaseID:FBgn0032172 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster


Alignment Length:312 Identity:59/312 - (18%)
Similarity:106/312 - (33%) Gaps:100/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILIGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFFPKHSIYVDSL 116
            |.|..|..:..:.:....:.:...|..||:|...|: ::.:.||.::.|.:.:..| :|.::   
  Fly    51 IFIASLLTILNISIFATTVSRLRRHLDKPLLGPSIM-MVGLYPIISVAALVTILVP-YSWFI--- 110

  Fly   117 RECYEA-YVIYN-----FMVYLLNYLNLGMDL------EATMEYKPQVPHFFPLCC---MRPWVM 166
              |:.. :|::.     |...|..|:....:.      ||.....|      |.||   ..|.|:
  Fly   111 --CHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTP------PCCCCCLCLPMVI 167

  Fly   167 GREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPY----IVVVNNISQF--V 225
            ..:    .|..|.:|.|.:                          .|:    |::|.||..:  :
  Fly   168 PTK----AKLCISRYMVWQ--------------------------MPFWQGSIMLVMNILYYRDI 202

  Fly   226 AMYCLVLFY-----------------------RANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLL 267
            .:|..|:|:                       ...:.|.:..|   |..|::.||..     ..|
  Fly   203 QLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRK---KMFCLQLVVML-----CKL 259

  Fly   268 NVLVYYNIIKDI-FGSD--VGDTNLASLLQNFLICIEMFIAA--VAHIYSFP 314
            ..||.|:.:..| .|.:  :..|.....:.|.||.:||.:.:  |...|..|
  Fly   260 QYLVLYDQLDGIKMGGEYPINHTVYKQTIINILILVEMVLVSMMVQSAYRTP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5850NP_001260310.1 Solute_trans_a 51..317 CDD:281602 59/312 (19%)
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 57/308 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23423
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.