DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5850 and Tmem184a

DIOPT Version :9

Sequence 1:NP_001260310.1 Gene:CG5850 / 34327 FlyBaseID:FBgn0032172 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_038945317.1 Gene:Tmem184a / 304325 RGDID:1306702 Length:460 Species:Rattus norvegicus


Alignment Length:436 Identity:134/436 - (30%)
Similarity:206/436 - (47%) Gaps:87/436 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VKDGFQRNDQLIL-------IGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYAL 98
            |.:|.|...||.|       :.|:||.:|:.::...|..|:..:|.|..|:.:||:|::|||||.
  Rat    76 VDNGSQGAPQLFLTSALARGVSGVFVWTALLLTGHQIYSHLRSYTVPREQRFVIRLLFIVPIYAF 140

  Fly    99 NAWIGLFF---PKHSIYVDSLRECYEAYVIYNFMVYLLNYLNLGMDLEATMEYKP-QVPHFFPLC 159
            ::|:.|..   ..:.:|.||:|:||||:|||:|:.....||.....:.|.:..|| :...|:..|
  Rat   141 DSWLSLLLLGGHPYYVYFDSVRDCYEAFVIYSFLTLCFQYLGGESAIMAEIRGKPIRSSCFYGTC 205

  Fly   160 CMRPWVMGREFIHNCKHGILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVNNISQF 224
            |:|.......|:..||...||:.:|:|:...|::|.:....|.:|:|..:..:.|:.:|.|.|..
  Rat   206 CLRGMSYSITFLRFCKQATLQFCIVKPVMALITIILQAFDKYHDGDFNIHSGYLYVTLVYNASVS 270

  Fly   225 VAMYCLVLFYRANKEDLKPMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKD---IFGSDVGD 286
            :|:|.|.|||.|.::.|:|.:|:.|||.|||::|.||:||:||.:|....:|.:   :.|:.||.
  Rat   271 LALYALFLFYFATRDLLRPFEPVLKFLTIKAIIFLSFWQGMLLAILERCGVIPEVQAVDGTRVGA 335

  Fly   287 TNLASLLQNFLICIEMFIAAVAHIYSFPHHPFHINSPQYWNNPNHSWCRAFLSMMDISDMQEDVT 351
            ..||:..|||||||||..|::|..|:||       |..|....|                     
  Rat   336 GTLAAGYQNFLICIEMLFASLALRYAFP-------SQVYSEKKN--------------------- 372

  Fly   352 EHLGVVGSSLSRRFQGRSTYQPLARSPRRS-SSESEYLISKRQDQQLPGNSSQSAGVADDGNSSN 415
                                .|...:|.:| ||..:..||       |.:..|.|  ..:.:.:.
  Rat   373 --------------------SPAPPAPMQSISSGLKETIS-------PQDIVQDA--IHNFSPAY 408

  Fly   416 SNYQQQQLHL---PGAAG-SQPSTRQRDTLHLRERERDPGAGAGGG 457
            ..|.||..|.   ||..| ..|||..           .|.:|:|||
  Rat   409 QQYTQQSTHEAPGPGQGGHPSPSTHP-----------GPASGSGGG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5850NP_001260310.1 Solute_trans_a 51..317 CDD:281602 102/279 (37%)
Tmem184aXP_038945317.1 Solute_trans_a 96..365 CDD:397604 100/275 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D411703at33208
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.