DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5850 and TMEM184B

DIOPT Version :9

Sequence 1:NP_001260310.1 Gene:CG5850 / 34327 FlyBaseID:FBgn0032172 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_016884243.1 Gene:TMEM184B / 25829 HGNCID:1310 Length:452 Species:Homo sapiens


Alignment Length:380 Identity:113/380 - (29%)
Similarity:191/380 - (50%) Gaps:55/380 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IGGLFVLSAVPVSIWHIIQHVIHFTKPILQKHIIRILWMVPIYALNAWIGLFF---PKHSIYVDS 115
            |.|.||.:|:.::...|..|:..::.|..|::|:|||::|||||.::|:.|.|   .::.:|..:
Human    82 ISGFFVWTALLITCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGT 146

  Fly   116 LRECYEAYVIYNFMVYLLNYLNLGMDLEATMEYKP-QVPHFFPLCCM--RPWVMGREFIHNCKHG 177
            :|:||||.|||||:.....||.....:.:.:..|| :....:..||:  :.:.:|  |:..||..
Human   147 VRDCYEALVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIG--FLRFCKQA 209

  Fly   178 ILQYTVVRPITTFISVICELCGVYGEGEFAGNVAFPYIVVVNNISQFVAMYCLVLFYRANKEDLK 242
            .||:.||:|:....:|:.:..|.|.:|:|.....:.|:.::.|||..:|:|.|.|||.|.:|.|.
Human   210 TLQFCVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLS 274

  Fly   243 PMKPIPKFLCIKAVVFFSFFQGVLLNVLVYYNIIKDIFGS--DVGDTNLASLLQNFLICIEMFIA 305
            |..|:.||..:|:|:|.||:||:||.:|.....|..|..:  .||:..:|:..|:|:||:|||.|
Human   275 PYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIICVEMFFA 339

  Fly   306 AVAHIYSFPHHPF-------HINSP---------------------QYWNNPN-------HSWCR 335
            |:|..::|.:..:       ..:||                     :...||:       |::..
Human   340 ALALRHAFTYKVYADKRLDAQASSPAPPAPCPAGRCAPMKSISSSLKETMNPHDIVQDAIHNFSP 404

  Fly   336 AFLSMMDISDMQEDVTEHLGVVGSSLSRRFQGRSTYQPLARSPRRS---SSESEY 387
            |:......|.::...|...|..|.|.|....|       ||...::   ||:.|:
Human   405 AYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSG-------ARDNEKTLLLSSDDEF 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5850NP_001260310.1 Solute_trans_a 51..317 CDD:281602 95/270 (35%)
TMEM184BXP_016884243.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D411703at33208
OrthoFinder 1 1.000 - - FOG0000529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1529
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.