DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5850 and osta-3

DIOPT Version :9

Sequence 1:NP_001260310.1 Gene:CG5850 / 34327 FlyBaseID:FBgn0032172 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_497071.1 Gene:osta-3 / 175140 WormBaseID:WBGene00012182 Length:348 Species:Caenorhabditis elegans


Alignment Length:270 Identity:57/270 - (21%)
Similarity:108/270 - (40%) Gaps:65/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LQKHIIRILWMV---PIYALNAWIGLFFPKHSIYVDSLRECYEAYVIYNF-MVYLLNYLNLGMDL 142
            ::|...::.|::   |:....::|.:..|:.::.:..:...|  |::..| :|.|..:|..|.:.
 Worm    78 IEKRRNKLYWLIAVFPVACSCSFIAMCVPRTAVILTCIGVLY--YLMCLFVIVSLARHLFGGRES 140

  Fly   143 EAT-MEYKPQVPHFF--PLCCMRPWV----MGREFIHNCKHGILQYTVVRPITTFISVI------ 194
            .:| ::|..:...|.  |.||:.|.:    ...:.|...:..:||..:||.|..|:.|:      
 Worm   141 FSTCLQYDDRPIDFRSPPFCCIIPKLPTARSTEKNIRRLEWCVLQAPIVRSIIIFLDVVAVAEMR 205

  Fly   195 ------------CELC----GVYGEGEFAGNVAFPYIVVVNNISQFVAMYCLVLFYRANKEDLKP 243
                        ..||    .::|....|.       |..|.:|    .||.:..:|        
 Worm   206 EDATPYIRYSDMASLCSLLLAIFGVHTLAR-------VTSNKLS----AYCFMSMFR-------- 251

  Fly   244 MKPIPKFLCIKAVVFFSFFQGVLL-NVLVYYNIIKDIFGSDVGDTNLASLLQNFLICIEMFIAAV 307
                   |...:::|||..|.::. |||:.:|:|.  .|..:.....|..:.||:|..||.:.:|
 Worm   252 -------LVDISLLFFSAQQPMIFQNVLLRFNLIS--CGPLLNAQENAYFVCNFIITCEMLLLSV 307

  Fly   308 AHIYSF-PHH 316
            ...:.. |.|
 Worm   308 LATWLLAPRH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5850NP_001260310.1 Solute_trans_a 51..317 CDD:281602 57/270 (21%)
osta-3NP_497071.1 Solute_trans_a 50..311 CDD:281602 55/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.