DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and Kidins220

DIOPT Version :9

Sequence 1:NP_001303318.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_006515313.1 Gene:Kidins220 / 77480 MGIID:1924730 Length:1794 Species:Mus musculus


Alignment Length:239 Identity:61/239 - (25%)
Similarity:107/239 - (44%) Gaps:60/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QSTVLTNLQRGNTE--------ATFCPVE-----VSLSFHERAGQGEITEEQVAAERARQQNIDY 95
            |:.::...::||.|        ...|.:|     .:|....:.|...|.||.:..    ..|:::
Mouse    39 QTPLMIAAEQGNVEIVKELIKNGANCNLEDLDNWTALISASKEGHIHIVEELLKC----GANLEH 99

  Fly    96 KDAHGFTALHWAASYGQLVSVQLLVAAGANVN-TMAPDLISPLLLAAAGGHNEIVRFLLEHGAD- 158
            :|..|:|||.||...|:...|:||::.|||.: |.....:.|::.||..||.:||..||::||. 
Mouse   100 RDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLQYSVYPIIWAAGRGHADIVHLLLQNGAKV 164

  Fly   159 ----------------SGHMDIVGN----------------TALMYAAAGNHPHTCNELLAKDLD 191
                            .||::.|.:                |||:.|..|.:..:..|:|.::.:
Mouse   165 NCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQEGANSMTALIVAVKGGYTQSVKEILKRNPN 229

  Fly   192 LSATNEDGDTAYSLAVEHG-AHLAQALLEQYMTAIITAGAFGSI 234
            ::.|::||:||..:|.:.| ..:.|.||:        ||.:.:|
Mouse   230 VNLTDKDGNTALMIASKEGHIEIVQDLLD--------AGTYVNI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_001303318.1 ANK 94..218 CDD:238125 44/158 (28%)
ANK repeat 99..130 CDD:293786 14/31 (45%)
Ank_2 104..196 CDD:289560 32/125 (26%)
ANK repeat 132..163 CDD:293786 13/47 (28%)
ANK repeat 165..196 CDD:293786 8/46 (17%)
Ank_2 170..234 CDD:289560 17/64 (27%)
Kidins220XP_006515313.1 Ank_4 13..58 CDD:372654 4/18 (22%)
ANK repeat 38..68 CDD:293786 5/28 (18%)
PHA02874 49..>378 CDD:165205 60/229 (26%)
ANK repeat 70..101 CDD:293786 6/34 (18%)
ANK repeat 103..132 CDD:293786 13/28 (46%)
ANK repeat 170..198 CDD:293786 3/27 (11%)
ANK repeat 236..267 CDD:293786 12/38 (32%)
ANK repeat 269..299 CDD:293786
ANK repeat 302..332 CDD:293786
ANK repeat 335..366 CDD:293786
PHA02736 <349..413 CDD:165103
KAP_NTPase 441..954 CDD:284995
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.