Sequence 1: | NP_001303318.1 | Gene: | CG5846 / 34326 | FlyBaseID: | FBgn0032171 | Length: | 234 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006515313.1 | Gene: | Kidins220 / 77480 | MGIID: | 1924730 | Length: | 1794 | Species: | Mus musculus |
Alignment Length: | 239 | Identity: | 61/239 - (25%) |
---|---|---|---|
Similarity: | 107/239 - (44%) | Gaps: | 60/239 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 QSTVLTNLQRGNTE--------ATFCPVE-----VSLSFHERAGQGEITEEQVAAERARQQNIDY 95
Fly 96 KDAHGFTALHWAASYGQLVSVQLLVAAGANVN-TMAPDLISPLLLAAAGGHNEIVRFLLEHGAD- 158
Fly 159 ----------------SGHMDIVGN----------------TALMYAAAGNHPHTCNELLAKDLD 191
Fly 192 LSATNEDGDTAYSLAVEHG-AHLAQALLEQYMTAIITAGAFGSI 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5846 | NP_001303318.1 | ANK | 94..218 | CDD:238125 | 44/158 (28%) |
ANK repeat | 99..130 | CDD:293786 | 14/31 (45%) | ||
Ank_2 | 104..196 | CDD:289560 | 32/125 (26%) | ||
ANK repeat | 132..163 | CDD:293786 | 13/47 (28%) | ||
ANK repeat | 165..196 | CDD:293786 | 8/46 (17%) | ||
Ank_2 | 170..234 | CDD:289560 | 17/64 (27%) | ||
Kidins220 | XP_006515313.1 | Ank_4 | 13..58 | CDD:372654 | 4/18 (22%) |
ANK repeat | 38..68 | CDD:293786 | 5/28 (18%) | ||
PHA02874 | 49..>378 | CDD:165205 | 60/229 (26%) | ||
ANK repeat | 70..101 | CDD:293786 | 6/34 (18%) | ||
ANK repeat | 103..132 | CDD:293786 | 13/28 (46%) | ||
ANK repeat | 170..198 | CDD:293786 | 3/27 (11%) | ||
ANK repeat | 236..267 | CDD:293786 | 12/38 (32%) | ||
ANK repeat | 269..299 | CDD:293786 | |||
ANK repeat | 302..332 | CDD:293786 | |||
ANK repeat | 335..366 | CDD:293786 | |||
PHA02736 | <349..413 | CDD:165103 | |||
KAP_NTPase | 441..954 | CDD:284995 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0502 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |