DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and ANKRA2

DIOPT Version :9

Sequence 1:NP_001303318.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_075526.1 Gene:ANKRA2 / 57763 HGNCID:13208 Length:313 Species:Homo sapiens


Alignment Length:236 Identity:76/236 - (32%)
Similarity:113/236 - (47%) Gaps:18/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ANTIQTNANSD---------DDEGVRSAPTSML----VLDAKRKSAFLPYRPQSTVLTNLQRGNT 56
            :..||...|||         .:..:.::|:..:    |........|.|.: |||.|||..|||.
Human    77 SKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIK-QSTTLTNKHRGNE 140

  Fly    57 EATFCPVEVSLSFHERAGQGEITEEQVAAERARQQN-IDYKDAHGFTALHWAASYGQLVSVQLLV 120
            .:|...:..|||.|:.|.|||:.   ..|.|..|:| |::.|..|||.|.|||::||:..|:.|:
Human   141 VSTTPLLANSLSVHQLAAQGEML---YLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLL 202

  Fly   121 AAGANVNTMAPDLISPLLLAAAGGHNEIVRFLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNEL 185
            ..||:...:.....|.|.||.:.|:.:||:.||:.|.|....|..|.|.|:||..|||......|
Human   203 QNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKML 267

  Fly   186 LAKDLDLSATNEDGDTAYSLAVEHGAHLAQALLEQYMTAII 226
            |....|.:...:.|..:..|||..|....|.::|.::..::
Human   268 LESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_001303318.1 ANK 94..218 CDD:238125 43/123 (35%)
ANK repeat 99..130 CDD:293786 13/30 (43%)
Ank_2 104..196 CDD:289560 33/91 (36%)
ANK repeat 132..163 CDD:293786 11/30 (37%)
ANK repeat 165..196 CDD:293786 11/30 (37%)
Ank_2 170..234 CDD:289560 16/57 (28%)
ANKRA2NP_075526.1 ANK repeat 144..179 CDD:293786 13/37 (35%)
ANK 1 148..180 13/34 (38%)
Ank_4 153..202 CDD:290365 21/51 (41%)
ANK 176..296 CDD:238125 42/119 (35%)
ANK 2 181..213 13/31 (42%)
ANK repeat 181..212 CDD:293786 13/30 (43%)
Ank_2 186..277 CDD:289560 33/90 (37%)
ANK 3 214..246 11/31 (35%)
ANK repeat 214..245 CDD:293786 11/30 (37%)
ANK 4 247..279 11/31 (35%)
ANK repeat 247..277 CDD:293786 11/29 (38%)
ANK 5 280..313 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I4918
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348558at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41378
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24124
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5508
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.