DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and kidins220a

DIOPT Version :9

Sequence 1:NP_001303318.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_009291458.1 Gene:kidins220a / 570732 ZFINID:ZDB-GENE-041014-170 Length:1713 Species:Danio rerio


Alignment Length:197 Identity:54/197 - (27%)
Similarity:88/197 - (44%) Gaps:46/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RAGQGEITEEQVAAERARQQNIDYKDAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISP 136
            :.|..::.:|.:    ....|::::|..|::||.|||..|::....||:..|||.|......:.|
Zfish    88 KEGHTDVVKELL----ENNANVEHRDMGGWSALMWAAYKGRVEVAGLLLEKGANPNITGQYSVYP 148

  Fly   137 LLLAAAGGHNEIVRFLLEHGAD-----------------SGHMDIV----------------GNT 168
            ::.||..||.|||:.||:|.|.                 .||.|.|                ..|
Zfish   149 IIWAAGRGHAEIVQLLLQHEAKVNCSDKYGTTPLIWASRKGHYDCVMHLLENGANVDQEGANSMT 213

  Fly   169 ALMYAAAGNHPHTCNELLAKDLDLSATNEDGDTAYSL-AVEHGAHLAQALLEQYMTAIITAGAFG 232
            ||:.|..|.......|||.::.:::.|::||:||..: |:|....:.|.||:        ||.:.
Zfish   214 ALIVAVRGGFTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGYTEIVQDLLD--------AGTYV 270

  Fly   233 SI 234
            :|
Zfish   271 NI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_001303318.1 ANK 94..218 CDD:238125 46/157 (29%)
ANK repeat 99..130 CDD:293786 13/30 (43%)
Ank_2 104..196 CDD:289560 35/124 (28%)
ANK repeat 132..163 CDD:293786 14/47 (30%)
ANK repeat 165..196 CDD:293786 9/46 (20%)
Ank_2 170..234 CDD:289560 18/64 (28%)
kidins220aXP_009291458.1 ANK 40..165 CDD:238125 25/80 (31%)
ANK repeat 45..76 CDD:293786
Ank_2 50..141 CDD:289560 17/56 (30%)
ANK repeat 78..109 CDD:293786 3/24 (13%)
ANK repeat 112..142 CDD:293786 13/29 (45%)
ANK repeat 144..175 CDD:293786 12/30 (40%)
Ank_2 149..241 CDD:289560 23/91 (25%)
ANK 172..297 CDD:238125 25/109 (23%)
ANK repeat 177..205 CDD:293786 4/27 (15%)
ANK repeat 210..241 CDD:293786 8/30 (27%)
Ank_2 215..306 CDD:289560 19/66 (29%)
ANK 238..363 CDD:238125 13/43 (30%)
ANK repeat 243..274 CDD:293786 12/38 (32%)
ANK repeat 276..306 CDD:293786
Ank_2 281..373 CDD:289560
ANK repeat 309..373 CDD:293786
Ank_5 362..418 CDD:290568
KAP_NTPase 448..959 CDD:284995
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.