Sequence 1: | NP_001303318.1 | Gene: | CG5846 / 34326 | FlyBaseID: | FBgn0032171 | Length: | 234 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009291458.1 | Gene: | kidins220a / 570732 | ZFINID: | ZDB-GENE-041014-170 | Length: | 1713 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 54/197 - (27%) |
---|---|---|---|
Similarity: | 88/197 - (44%) | Gaps: | 46/197 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 RAGQGEITEEQVAAERARQQNIDYKDAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISP 136
Fly 137 LLLAAAGGHNEIVRFLLEHGAD-----------------SGHMDIV----------------GNT 168
Fly 169 ALMYAAAGNHPHTCNELLAKDLDLSATNEDGDTAYSL-AVEHGAHLAQALLEQYMTAIITAGAFG 232
Fly 233 SI 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5846 | NP_001303318.1 | ANK | 94..218 | CDD:238125 | 46/157 (29%) |
ANK repeat | 99..130 | CDD:293786 | 13/30 (43%) | ||
Ank_2 | 104..196 | CDD:289560 | 35/124 (28%) | ||
ANK repeat | 132..163 | CDD:293786 | 14/47 (30%) | ||
ANK repeat | 165..196 | CDD:293786 | 9/46 (20%) | ||
Ank_2 | 170..234 | CDD:289560 | 18/64 (28%) | ||
kidins220a | XP_009291458.1 | ANK | 40..165 | CDD:238125 | 25/80 (31%) |
ANK repeat | 45..76 | CDD:293786 | |||
Ank_2 | 50..141 | CDD:289560 | 17/56 (30%) | ||
ANK repeat | 78..109 | CDD:293786 | 3/24 (13%) | ||
ANK repeat | 112..142 | CDD:293786 | 13/29 (45%) | ||
ANK repeat | 144..175 | CDD:293786 | 12/30 (40%) | ||
Ank_2 | 149..241 | CDD:289560 | 23/91 (25%) | ||
ANK | 172..297 | CDD:238125 | 25/109 (23%) | ||
ANK repeat | 177..205 | CDD:293786 | 4/27 (15%) | ||
ANK repeat | 210..241 | CDD:293786 | 8/30 (27%) | ||
Ank_2 | 215..306 | CDD:289560 | 19/66 (29%) | ||
ANK | 238..363 | CDD:238125 | 13/43 (30%) | ||
ANK repeat | 243..274 | CDD:293786 | 12/38 (32%) | ||
ANK repeat | 276..306 | CDD:293786 | |||
Ank_2 | 281..373 | CDD:289560 | |||
ANK repeat | 309..373 | CDD:293786 | |||
Ank_5 | 362..418 | CDD:290568 | |||
KAP_NTPase | 448..959 | CDD:284995 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0502 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |