DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and ankra2

DIOPT Version :9

Sequence 1:NP_001303318.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001006692.1 Gene:ankra2 / 448315 XenbaseID:XB-GENE-1002386 Length:312 Species:Xenopus tropicalis


Alignment Length:237 Identity:76/237 - (32%)
Similarity:114/237 - (48%) Gaps:20/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ANTIQTNANSD---------DDEGVRSAPTSML----VLDAKRKSAFLPYRPQSTVLTNLQRGNT 56
            :..||...|||         .:..:.::|:..:    |........|.|.: |||.|||..||| 
 Frog    76 SKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVYTPSTTKHFSPIK-QSTTLTNKHRGN- 138

  Fly    57 EATFCPVEV-SLSFHERAGQGEITEEQVAAERARQQN-IDYKDAHGFTALHWAASYGQLVSVQLL 119
            |.:..|:.| |||.|:.|.|||:.   ..|.|..|:| ::..|..|||.|.|||::||:..|:.|
 Frog   139 EVSTTPLLVNSLSVHQLAAQGEMV---YLASRLEQENVVNLTDEEGFTPLMWAAAHGQIAVVEFL 200

  Fly   120 VAAGANVNTMAPDLISPLLLAAAGGHNEIVRFLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNE 184
            :..||:...:.....|.|.||.:.|:.:||:.|:|.|.|....|..|.|.|:||..|||......
 Frog   201 LQNGADPQVLGKGRESALSLACSKGYTDIVKMLVECGVDVNEYDWNGGTPLLYAVHGNHVKCVKI 265

  Fly   185 LLAKDLDLSATNEDGDTAYSLAVEHGAHLAQALLEQYMTAII 226
            ||....|.:...:.|..:..|:|..|....|.::|.::..::
 Frog   266 LLENGADPTIETDSGYNSMDLSVALGHRSVQQVIETHLLQLL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_001303318.1 ANK 94..218 CDD:238125 42/123 (34%)
ANK repeat 99..130 CDD:293786 13/30 (43%)
Ank_2 104..196 CDD:289560 33/91 (36%)
ANK repeat 132..163 CDD:293786 11/30 (37%)
ANK repeat 165..196 CDD:293786 11/30 (37%)
Ank_2 170..234 CDD:289560 15/57 (26%)
ankra2NP_001006692.1 Ank_2 <132..209 CDD:372319 34/80 (43%)
ANK repeat 143..178 CDD:293786 14/37 (38%)
ANK repeat 180..211 CDD:293786 13/30 (43%)
Ank_2 185..275 CDD:372319 33/89 (37%)
ANK repeat 213..244 CDD:293786 11/30 (37%)
ANK repeat 246..276 CDD:293786 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348558at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48581
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5508
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.090

Return to query results.
Submit another query.