DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and Arms

DIOPT Version :10

Sequence 1:NP_609333.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_726059.5 Gene:Arms / 37433 FlyBaseID:FBgn0261554 Length:1642 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:105/262 - (40%) Gaps:72/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDDEGVRSAPTSMLVLDAKRKSAFLPYRPQSTVLTNLQRG---------NTEATFCPVEVSLSFH 70
            |.||   :|.|.::|:..:..:||        |...|.||         |..|..|         
  Fly   198 DRDE---NATTVLMVVAGRGLTAF--------VREFLARGADVQAEDLDNWTALLC--------- 242

  Fly    71 ERAGQGEITEEQVAAERARQQNIDYKDAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAPDLIS 135
             .:..|.:...|:..:...:  ::::|..|:|:|.|||..|....|:||:..||:.|......:.
  Fly   243 -ASRNGHLDVVQLLLDHGAE--VEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLG 304

  Fly   136 PLLLAAAGGHNEIVRFLLEHGADSGHMDIVGNTALMY---------------------------- 172
            .||.||..|:.:||..|::.||.....|..|.|||::                            
  Fly   305 ALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSW 369

  Fly   173 -----AAAGNHPHTCNELLAKDLDLSATNEDGDTAYSLAVEHGAHLAQALLEQYMTAIITAGAFG 232
                 ||||.|....:.:|.|..:::|.::||.||..:|...|       .:....::|.|||:.
  Fly   370 TPLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREG-------FQDIAASLIAAGAYI 427

  Fly   233 SI 234
            :|
  Fly   428 NI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_609333.1 ANKYR <92..232 CDD:440430 47/172 (27%)
ANK repeat 99..130 CDD:293786 13/30 (43%)
ANK repeat 132..163 CDD:293786 10/30 (33%)
ANK repeat 165..196 CDD:293786 12/63 (19%)
ArmsNP_726059.5 ANKYR 172..438 CDD:440430 65/262 (25%)
ANK repeat 205..233 CDD:293786 8/35 (23%)
ANK repeat 235..266 CDD:293786 5/42 (12%)
ANK repeat 268..299 CDD:293786 13/30 (43%)
ANK repeat 301..332 CDD:293786 10/30 (33%)
ANKYR 316..598 CDD:440430 29/121 (24%)
ANK repeat 334..362 CDD:293786 4/27 (15%)
ANK repeat 367..398 CDD:293786 8/30 (27%)
ANK repeat 400..431 CDD:293786 11/37 (30%)
ANK repeat 435..464 CDD:293786
ANK repeat 466..497 CDD:293786
ANK repeat 499..530 CDD:293786
KAP_NTPase 605..1136 CDD:462231
SAM_superfamily 1357..1392 CDD:188886
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.