| Sequence 1: | NP_001303318.1 | Gene: | CG5846 / 34326 | FlyBaseID: | FBgn0032171 | Length: | 234 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005160694.1 | Gene: | kidins220b / 335881 | ZFINID: | ZDB-GENE-030131-7824 | Length: | 1732 | Species: | Danio rerio |
| Alignment Length: | 198 | Identity: | 57/198 - (28%) |
|---|---|---|---|
| Similarity: | 90/198 - (45%) | Gaps: | 47/198 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 72 RAGQGEITEEQVAAERARQQNIDYKDAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAPDL-IS 135
Fly 136 PLLLAAAGGHNEIVRFLLEHGAD-----------------SGHMDIV----------------GN 167
Fly 168 TALMYAAAGNHPHTCNELLAKDLDLSATNEDGDTAYSLAVEHG-AHLAQALLEQYMTAIITAGAF 231
Fly 232 GSI 234 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5846 | NP_001303318.1 | ANK | 94..218 | CDD:238125 | 48/158 (30%) |
| ANK repeat | 99..130 | CDD:293786 | 13/30 (43%) | ||
| Ank_2 | 104..196 | CDD:289560 | 36/125 (29%) | ||
| ANK repeat | 132..163 | CDD:293786 | 16/48 (33%) | ||
| ANK repeat | 165..196 | CDD:293786 | 9/46 (20%) | ||
| Ank_2 | 170..234 | CDD:289560 | 18/64 (28%) | ||
| kidins220b | XP_005160694.1 | Ank_4 | 17..66 | CDD:290365 | |
| ANK | 40..199 | CDD:238125 | 36/114 (32%) | ||
| ANK repeat | 45..76 | CDD:293786 | |||
| Ank_2 | 50..141 | CDD:289560 | 17/56 (30%) | ||
| ANK repeat | 78..109 | CDD:293786 | 4/24 (17%) | ||
| ANK repeat | 111..139 | CDD:293786 | 11/27 (41%) | ||
| ANK repeat | 149..176 | CDD:293786 | 14/26 (54%) | ||
| Ank_2 | 150..242 | CDD:289560 | 25/91 (27%) | ||
| ANK | 173..298 | CDD:238125 | 25/109 (23%) | ||
| ANK repeat | 178..209 | CDD:293786 | 4/30 (13%) | ||
| ANK repeat | 211..242 | CDD:293786 | 8/30 (27%) | ||
| Ank_2 | 216..307 | CDD:289560 | 19/66 (29%) | ||
| ANK | 239..397 | CDD:238125 | 13/43 (30%) | ||
| ANK repeat | 244..275 | CDD:293786 | 12/38 (32%) | ||
| ANK repeat | 277..308 | CDD:293786 | |||
| ANK repeat | 310..374 | CDD:293786 | |||
| Ank_2 | 315..402 | CDD:289560 | |||
| KAP_NTPase | 449..960 | CDD:284995 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||