DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and Rfxank

DIOPT Version :9

Sequence 1:NP_001303318.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001013154.1 Gene:Rfxank / 306353 RGDID:1311390 Length:284 Species:Rattus norvegicus


Alignment Length:231 Identity:79/231 - (34%)
Similarity:119/231 - (51%) Gaps:17/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PANTIQTNANSDDDEGVRSAPTSMLVLDAKRKSAFLPYRPQSTVLTNLQRGNTEATFCPVEV-SL 67
            ||.::.|........|.::.|  :|.      .:||.:   ||.|||.|||| |.:..|..: ||
  Rat    64 PAASVWTPLAQAQTPGEQALP--LLA------GSFLKH---STTLTNRQRGN-EVSALPATLDSL 116

  Fly    68 SFHERAGQGEITEEQVAAERARQQNIDYK-DAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAP 131
            |.|:.|.|||::  |:.....:..|:..| |..|||.|.||:::|::.:|:.|:..||:.:.:|.
  Rat   117 SIHQLAAQGELS--QLKDHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLDWGADPHILAK 179

  Fly   132 DLISPLLLAAAGGHNEIVRFLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNELLAKDLDLSATN 196
            :..|.|.||:.||:.:|||.||:...|....|..|.|.|:||..|||......|||:..||:...
  Rat   180 ERESALSLASMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEA 244

  Fly   197 EDGDTAYSLAVEHGAHLAQALLEQYMTAIITAGAFG 232
            :.|.|...|||..|....|.::|.::..:. .|..|
  Rat   245 DSGYTPMDLAVALGYRKVQQVMESHILKLF-QGTLG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_001303318.1 ANK 94..218 CDD:238125 47/124 (38%)
ANK repeat 99..130 CDD:293786 11/30 (37%)
Ank_2 104..196 CDD:289560 35/91 (38%)
ANK repeat 132..163 CDD:293786 12/30 (40%)
ANK repeat 165..196 CDD:293786 13/30 (43%)
Ank_2 170..234 CDD:289560 21/63 (33%)
RfxankNP_001013154.1 ANKYR 89..271 CDD:223738 71/187 (38%)
ANK repeat 118..145 CDD:293786 8/28 (29%)
ANK repeat 147..178 CDD:293786 11/30 (37%)
Ank_2 152..242 CDD:403870 35/89 (39%)
ANK repeat 180..211 CDD:293786 12/30 (40%)
ANK repeat 213..241 CDD:293786 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0502
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2760
Inparanoid 1 1.050 108 1.000 Inparanoid score I4816
OMA 1 1.010 - - QHG47600
OrthoDB 1 1.010 - - D1348558at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45498
orthoMCL 1 0.900 - - OOG6_112256
Panther 1 1.100 - - LDO PTHR24124
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.