DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and NKPD1

DIOPT Version :9

Sequence 1:NP_001303318.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_011525101.1 Gene:NKPD1 / 284353 HGNCID:24739 Length:859 Species:Homo sapiens


Alignment Length:60 Identity:18/60 - (30%)
Similarity:24/60 - (40%) Gaps:16/60 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LLVAAGANVNTMAPDLISPLLLAAAGGHNEIVRFLLEHGADSGH-MDIVGNTALMYAAAG 176
            ||.|.|..|.         ||..:.|||      .|.||:.||. :.:.|..|...:.:|
Human   374 LLAALGLGVG---------LLYLSLGGH------ALGHGSPSGSLLKVFGGAATTLSGSG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_001303318.1 ANK 94..218 CDD:238125 18/60 (30%)
ANK repeat 99..130 CDD:293786 5/11 (45%)
Ank_2 104..196 CDD:289560 18/60 (30%)
ANK repeat 132..163 CDD:293786 10/31 (32%)
ANK repeat 165..196 CDD:293786 3/12 (25%)
Ank_2 170..234 CDD:289560 1/7 (14%)
NKPD1XP_011525101.1 P-loop_NTPase 286..591 CDD:304359 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.