DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and LOC102552223

DIOPT Version :9

Sequence 1:NP_001303318.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_038950973.1 Gene:LOC102552223 / 102552223 RGDID:7638512 Length:283 Species:Rattus norvegicus


Alignment Length:158 Identity:33/158 - (20%)
Similarity:60/158 - (37%) Gaps:49/158 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VRSAPTSMLVLDAKRKSAFLPYRPQSTVLTNLQRGNTEATFCPVEVSLSFHERAGQGEITEEQVA 84
            :||:|..:.:|    ||:...::..|.:.|...|.:.                        :|:.
  Rat     3 LRSSPQGLHLL----KSSVASHKSVSNLSTRAHRRHL------------------------KQMT 39

  Fly    85 AERARQQNIDYKDAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISPLL--------LAA 141
            ...||            |:||:|:::.....|.||:...:|:|....:..:||:        ||.
  Rat    40 PSLAR------------TSLHYASAHNHPDVVTLLLENKSNINIQDDEGCTPLIKYGLTPLQLAT 92

  Fly   142 AGGHNEIVRFLLEHGADSGHMDIVGNTA 169
            .....|::.||....||:..:. |.|:|
  Rat    93 YENQTEMINFLESMSADAQAVQ-VSNSA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_001303318.1 ANK 94..218 CDD:238125 21/84 (25%)
ANK repeat 99..130 CDD:293786 9/30 (30%)
Ank_2 104..196 CDD:289560 20/74 (27%)
ANK repeat 132..163 CDD:293786 9/38 (24%)
ANK repeat 165..196 CDD:293786 3/5 (60%)
Ank_2 170..234 CDD:289560 33/158 (21%)
LOC102552223XP_038950973.1 ANKYR 10..>124 CDD:223738 30/151 (20%)
ANK repeat 44..73 CDD:293786 10/40 (25%)
Ank_2 47..103 CDD:403870 13/55 (24%)
ANK repeat 75..113 CDD:293786 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D550644at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.