DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5846 and rfxank

DIOPT Version :9

Sequence 1:NP_001303318.1 Gene:CG5846 / 34326 FlyBaseID:FBgn0032171 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_002936373.2 Gene:rfxank / 100490142 XenbaseID:XB-GENE-1004063 Length:238 Species:Xenopus tropicalis


Alignment Length:216 Identity:76/216 - (35%)
Similarity:110/216 - (50%) Gaps:19/216 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QTNANSDDDEGVRSAPTSMLVLDAKRKSAFLPYRPQSTVLTNLQRGNTEATFCPVEVSLSFHERA 73
            |..:.||.:|.|       |.|:|    ..|.|   ||.|||.||||..:.......|||..:.|
 Frog    32 QAQSGSDVEEDV-------LPLNA----GPLQY---STTLTNRQRGNMVSVLPATLDSLSVQQLA 82

  Fly    74 GQGEITE--EQVAAERARQQNIDYKDAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISP 136
            .|||:|:  |.:..::|.   |:..|..|||.|.|||::|::.:|:.|:..||:.:.:|.:..|.
 Frog    83 AQGELTQLKEYIQKDKAL---INCPDERGFTPLMWAAAFGEIETVRYLLELGADPHILAKERESA 144

  Fly   137 LLLAAAGGHNEIVRFLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNELLAKDLDLSATNEDGDT 201
            |.||:.||:::||..||....|....|..|.|.|:||..|||......||.:..||:...:.|.|
 Frog   145 LSLASTGGYSDIVTLLLSKKVDINIYDWNGGTPLLYAVRGNHMKCVEVLLERGADLTMEADSGYT 209

  Fly   202 AYSLAVEHGAHLAQALLEQYM 222
            ...|||..|....|.::|.::
 Frog   210 PMDLAVALGYKKVQQVIEHHI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5846NP_001303318.1 ANK 94..218 CDD:238125 45/123 (37%)
ANK repeat 99..130 CDD:293786 12/30 (40%)
Ank_2 104..196 CDD:289560 34/91 (37%)
ANK repeat 132..163 CDD:293786 11/30 (37%)
ANK repeat 165..196 CDD:293786 12/30 (40%)
Ank_2 170..234 CDD:289560 18/53 (34%)
rfxankXP_002936373.2 PHA02875 6..>169 CDD:165206 55/153 (36%)
ANK repeat 107..138 CDD:293786 12/30 (40%)
Ank_2 112..202 CDD:372319 34/89 (38%)
ANK repeat 140..171 CDD:293786 11/30 (37%)
ANK repeat 173..203 CDD:293786 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2760
Inparanoid 1 1.050 104 1.000 Inparanoid score I4820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348558at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48581
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5508
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.