Sequence 1: | NP_001303318.1 | Gene: | CG5846 / 34326 | FlyBaseID: | FBgn0032171 | Length: | 234 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012818173.1 | Gene: | kidins220 / 100145198 | XenbaseID: | XB-GENE-5839632 | Length: | 1764 | Species: | Xenopus tropicalis |
Alignment Length: | 239 | Identity: | 63/239 - (26%) |
---|---|---|---|
Similarity: | 110/239 - (46%) | Gaps: | 60/239 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 QSTVLTNLQRGNTE--------ATFCPVE-----VSLSFHERAGQGEITEEQVAAERARQQNIDY 95
Fly 96 KDAHGFTALHWAASYGQLVSVQLLVAAGANVN-TMAPDLISPLLLAAAGGHNEIVRFLLEHGAD- 158
Fly 159 ----------------SGHMDIV----------------GNTALMYAAAGNHPHTCNELLAKDLD 191
Fly 192 LSATNEDGDTAYSLAVEHG-AHLAQALLEQYMTAIITAGAFGSI 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5846 | NP_001303318.1 | ANK | 94..218 | CDD:238125 | 46/158 (29%) |
ANK repeat | 99..130 | CDD:293786 | 15/31 (48%) | ||
Ank_2 | 104..196 | CDD:289560 | 34/125 (27%) | ||
ANK repeat | 132..163 | CDD:293786 | 13/47 (28%) | ||
ANK repeat | 165..196 | CDD:293786 | 9/46 (20%) | ||
Ank_2 | 170..234 | CDD:289560 | 18/64 (28%) | ||
kidins220 | XP_012818173.1 | Ank_4 | 9..58 | CDD:290365 | 4/18 (22%) |
ANK | 32..191 | CDD:238125 | 42/155 (27%) | ||
ANK repeat | 37..68 | CDD:293786 | 5/28 (18%) | ||
Ank_2 | 42..133 | CDD:289560 | 26/94 (28%) | ||
ANK repeat | 70..101 | CDD:293786 | 6/34 (18%) | ||
ANK repeat | 104..134 | CDD:293786 | 14/29 (48%) | ||
ANK repeat | 137..168 | CDD:293786 | 11/30 (37%) | ||
Ank_2 | 143..234 | CDD:289560 | 21/90 (23%) | ||
ANK | 165..290 | CDD:238125 | 24/109 (22%) | ||
ANK repeat | 170..198 | CDD:293786 | 3/27 (11%) | ||
Ank_2 | 208..299 | CDD:289560 | 19/66 (29%) | ||
ANK | 231..356 | CDD:238125 | 13/43 (30%) | ||
ANK repeat | 236..267 | CDD:293786 | 12/38 (32%) | ||
ANK repeat | 269..299 | CDD:293786 | |||
ANK repeat | 302..366 | CDD:293786 | |||
Ank_2 | 307..394 | CDD:289560 | |||
KAP_NTPase | 441..955 | CDD:284995 | |||
SAM_superfamily | 1215..1281 | CDD:301707 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |