DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4658 and OXR1

DIOPT Version :9

Sequence 1:NP_001285789.1 Gene:CG4658 / 34325 FlyBaseID:FBgn0032170 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_015128.1 Gene:OXR1 / 855905 SGDID:S000006117 Length:273 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:58/295 - (19%)
Similarity:94/295 - (31%) Gaps:110/295 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 STAYRGLEQQNQSCGIELQTPVLEQRNPFTDTTDFSGGSTREMDSLMPLSQAWLLAGALPPLYSK 311
            ||||        :...|....:.:..|||.:.|. |..:..|..||.|:.    |.|.||.  :|
Yeast    23 STAY--------TTASESSPQLKDSHNPFRNKTT-SERTIVEEGSLPPVR----LNGYLPS--TK 72

  Fly   312 PQTVTPPATKGNNNVSASTAVQIFKDKLSMMPSHWTLLYNSNEHGVGANRFLHHV---------L 367
            .:.:||........: ..|.:|::        :.|.|||:..:||...:....:|         :
Yeast    73 NKLLTPEMCDEIRTL-MPTRIQLY--------TEWNLLYSLEQHGSSLHSLYSNVAPDSKEFRRV 128

  Fly   368 GYRGPTLVLLHTKDEQTYCVASPSEWKETHLFVGGEGSCVIQLLPKFVILEKKPNILYLNTS--- 429
            ||   .||:...|:......::.:.....|....|.|.|.:..      |:|.|::   |.|   
Yeast   129 GY---VLVIKDRKNGIFGAYSNEAFHPNEHRQYTGNGECFLWK------LDKVPDV---NISEKE 181

  Fly   430 --------------------IRGYP-------------KGLRAGADPRKPIIAVDEHF------- 454
                                ..|||             :.|..||.        |.|:       
Yeast   182 ESEQEGKEGKEEGDKEERWRFSGYPYTGVNEFAIYCTSEFLSMGAG--------DGHYGLLCDDG 238

  Fly   455 --------------ENIDCKGLAAGLMSIEVWGCG 475
                          |.:..:|....::::|||..|
Yeast   239 LLHGVSNPCQTYGNEVLSKEGKKFSIVALEVWRVG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4658NP_001285789.1 TLDc 327..475 CDD:214733 36/213 (17%)
OXR1NP_015128.1 OXR1 40..273 CDD:227471 52/268 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.