DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4709 and STIPL1

DIOPT Version :9

Sequence 1:NP_001285788.1 Gene:CG4709 / 34324 FlyBaseID:FBgn0032169 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_173150.1 Gene:STIPL1 / 838277 AraportID:AT1G17070 Length:849 Species:Arabidopsis thaliana


Alignment Length:351 Identity:86/351 - (24%)
Similarity:146/351 - (41%) Gaps:89/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 VNFV--------EQICRVRLDGQDHK-ERERDFKFEELYPLTTDQ-DEDDE------LSSEESNS 266
            ||||        ::|.:   |.::|. |::|| |.|:     .|. |||.|      :.|.....
plant    82 VNFVSTGTVMPNQEIDK---DSREHNDEKDRD-KIED-----NDMIDEDVEVRGGLGIGSSGLGL 137

  Fly   267 SMNDNSSDEAESDMDDL-------EEARRARMVELSLFTFKPTE--------------RLGAWEE 310
            ..|.|..|    |.|:|       :.|.||:|...:....:..|              .:|.:|:
plant   138 GFNANGFD----DEDNLLPGALGKKIADRAKMRGKAKVEKRGQEGGGAKGGKKNTLGSDIGQFEK 198

  Fly   311 FTRGIGSKLMEKMGYIHGTGLGSDGRGIVTPVSAQILPQGRSLDACMELREAANGDKDYFSVERK 375
            .|:|||.||:||||| .|.|||.:.:|||.|:.||:.|:...: ...:.:||..  .|...||.|
plant   199 STKGIGMKLLEKMGY-KGGGLGKNQQGIVAPIEAQLRPKNMGM-GYNDFKEAKL--PDLKKVEEK 259

  Fly   376 ----LKRAQRRQRKAD-------EKAYVRESQRVDVFTFL---NDSVLGPGES--TQQGEQV--- 421
                :..::..|...|       :|..||::..|.....|   .::..|.|::  ..:|.||   
plant   260 KIIGVSVSENEQSHGDRGGKNLWKKKKVRKAVYVTAEELLEKKQEAGFGGGQTIIDMRGPQVRVV 324

  Fly   422 --------TKKAKTNELQ----QHSTKTL----NVETVRIADEIRRKQRDMAKVKQSLDRNSGDA 470
                    .:|||..::.    ||:.:.:    ..|..:|..::|.::.....::|..:....:.
plant   325 TNLENLDAEEKAKEADVPMPELQHNLRLIVDLVEHEIQKIDRDLRNERESALSLQQEKEMLINEE 389

  Fly   471 QLQKRLQVQMQSHKQELATLQAQERS 496
            :.|||....|:....|::.::.:..|
plant   390 EKQKRHLENMEYIADEISRIELENTS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4709NP_001285788.1 ZnF_C3H1 155..176 CDD:214632
G-patch 312..355 CDD:279867 22/42 (52%)
STIPL1NP_173150.1 TIP_N 6..105 CDD:289242 7/25 (28%)
G-patch 200..243 CDD:279867 22/44 (50%)
GCFC 420..687 CDD:285127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238995at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.