DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4709 and AT3G09850

DIOPT Version :9

Sequence 1:NP_001285788.1 Gene:CG4709 / 34324 FlyBaseID:FBgn0032169 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_566359.1 Gene:AT3G09850 / 820143 AraportID:AT3G09850 Length:781 Species:Arabidopsis thaliana


Alignment Length:106 Identity:33/106 - (31%)
Similarity:55/106 - (51%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 EDDELSSEESNSSMNDNSSDEAE-----SDMDDLEEARRARMVELSLFTFKPTERLGAWEEFTRG 314
            ||...||..:|::..:.||...:     :..:....:.|.|           .:||||:|:.|.|
plant   685 EDPSPSSNNNNNAKRNRSSSSGKHGKRITHDNGASGSGRIR-----------DKRLGAFEQHTTG 738

  Fly   315 IGSKLMEKMGYIHGTGLGSDGRGIVTPVSAQILPQGRSLDA 355
            .||::|.:||::.|:|||.:.:|||.|:.|...|:.|.:.|
plant   739 FGSRMMARMGFVEGSGLGRESQGIVNPLVAVRRPRARGIGA 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4709NP_001285788.1 ZnF_C3H1 155..176 CDD:214632
G-patch 312..355 CDD:279867 18/42 (43%)
AT3G09850NP_566359.1 R3H 456..513 CDD:412290
G-patch 635..679 CDD:396249
G-patch 736..780 CDD:396249 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1238995at2759
OrthoFinder 1 1.000 - - FOG0004918
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.